CAZyme Information: MGYG000002330_01553

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_01553
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601	MGYG000002330_50|CGC2	69298.88	5.7765

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 20568; End: 22373 Strand: +

Full Sequence      

MNKIFESAKPQQVRLLDSEIRRRFQVNEDLLLRYQSKDLLRSYYFEAGLWKDNSENPKIE
HWGWEGPTSEIRGHFVGHWLSAAAITYASDGNRELLGRAEYMLDELERCQKANGGEWIGA
IPEKQLRWTEEGRNFGVPLYNLHKIIMGLIDMYVYAGNCKALEIVGHFADWFYRWVKDIP
TDRMDIIMETETGGILEEWCRLYEITGEEKYQVLMEKFLRRPLFHALLENKDVLTNMHAN
TTIPEILGIARMYEVTGNPEYLKAVKNYWSIAVTKRGGFVTGGQTSGEVWIPPFHIRERL
GKLNQEHCAVYNMMRLAEFLYQYTGDIEFENYRELNLYNGILAQQNPNTGAAAYYLPMQA
GSRKIWSTEKKSFWCCCGSGIQAGASHGMGIYAENKNQIAVNQFIPSVLTSDRWERKVKI
TQQSGMAAKNVQKLIGINAGSVNYPEAFSVYLNIDASEAPDMTVLVRIPFWNQKDPVLLV
NGEQVDYYMENSCIYIPCGSKKLEVSIFFYQALTVHEMSGCSEMIAFRHGPVVLAGMTEK
DTIHGERGQIQNMLVHHNERIWGSWTREFRTTQEEVNINFKPLYEVADETYTVYFINENG
E

Enzyme Prediction     

No EC number prediction in MGYG000002330_01553.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	12	535	3.6e-154	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	8.65e-106	12	483	1	445	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.94e-65	6	485	5	449	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG4225	YesR	0.003	201	355	47	202	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAM48120.1	6.32e-168	9	595	5	615
AGA58936.1	3.93e-166	11	595	7	615
QBE99157.1	1.68e-164	4	595	3	617
QNF30959.1	2.03e-164	5	595	5	620
QIB58295.1	2.69e-163	8	595	7	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.43e-77	11	601	31	654	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	7.74e-71	11	601	31	654	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	4.97e-15	127	598	131	580	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	3.24e-13	76	533	79	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	7.46e-13	76	533	79	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_01553.