CAZyme Information: MGYG000002330_01606

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_01606
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817	MGYG000002330_50|CGC4	93522.61	5.8692

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 82577; End: 85030 Strand: +

Full Sequence      

MGRNINGEFEFDVIRHKDTAAAWSQELKVIFVLRGNGWLHTEEGDRTYAISREDIFVINS
FQMHSVVLEENGLAISLSLSPSFLAAASPETEDRNVNCKSFLHEEEKQQLFDIIRKDLAL
AFRAWYKKESELSIHLRSRVMALADDLYRYFSENGENTGRESGRERLRAAVEYIHRNYRE
GITLADLASQTYLSTSYISRSFQKYMGVSFTGYLTQVRLFHAALLLQGEGTVTEIAYESG
FSSASALIDAFKQYRGITPGQYRRNLGKRPVMDNAEEMKTAEGFSMAFVSLMKYADKAEE
AAEPVVTGVCEISVNTGIVKRQLRHTWKTMINAGYARDLLNASMQNQIMEIQKSIGFRYI
RCKGVVDDDMMLYSRDVNGNSSFNYVYLDQALDFILSAGAKPMLELGHMPSAMAQKKVQF
FKRPSFISPPAELEQWRLLIESLMEHLIGRYGMEELKKWLFVPWISMDMHLFGLFVKEDF
GEIYSVTYQEIKKACREFVICGPGTTLLSLEAAEWFCDLCRERDCIPDIFTVRSYAAIDP
EEEKSGLKLVENNESFYMAVDGDEDCLMHLRRKVKDFLEAEGEGFCGLPVLMDEWSNNIW
QRDLCNDTCYKSAYLFKSIMENHDSYYGLGYFSISDQLDEIAPAAEAFHGGFGLFTQNGI
AKSAYRAMQLLSRAGDKLIAKGSGYFITASEDEIQIFLHNYCHYDMLYRYRNTTNLTKTR
RYKVFQEKAPRSFHIQLEGVRPGRHEVRRYGIGRKGGSAYDAWIDMGAPEPMTKEEEKTL
MRLSSPVYRREEAEAEGLLKIKASLMPHEVCLITISI

Enzyme Prediction     

No EC number prediction in MGYG000002330_01606.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	321	771	1.9e-87	0.988399071925754

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	6.53e-50	321	787	12	458	Glycosyl hydrolases family 39.
COG3664	XynB	6.92e-32	339	813	1	422	Beta-xylosidase [Carbohydrate transport and metabolism].
COG2207	AraC	1.29e-31	160	271	15	127	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	2.37e-26	181	263	1	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	1.81e-21	187	265	1	81	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ24049.1	2.84e-266	5	816	7	818
AIQ37108.1	2.07e-150	23	810	30	819
AFC28613.1	2.44e-147	23	815	30	832
AEI39944.1	6.80e-147	23	815	30	832
AFH60783.1	3.74e-146	23	815	30	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1W91_A	5.22e-44	320	815	11	480	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BFG_A	1.31e-43	320	815	11	480	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
2BS9_A	1.77e-43	320	815	11	480	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4EKJ_A	1.93e-42	331	801	30	476	ChainA, Beta-xylosidase [Caulobacter vibrioides]
4M29_A	1.93e-42	331	801	30	476	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23552	1.88e-44	309	815	6	485	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
Q9ZFM2	5.15e-41	320	815	11	481	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
P36906	3.60e-35	327	812	18	476	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
O30360	1.18e-34	327	812	18	476	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
Q936F1	6.52e-22	27	815	23	739	Uncharacterized HTH-type transcriptional regulator OS=Staphylococcus aureus OX=1280 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_01606.