CAZyme Information: MGYG000002330_01868

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_01868
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849		98406.12	4.7361

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 38470; End: 41019 Strand: +

Full Sequence      

MTEKTLHTGWKMRRLGEMEWLPATVPGSVYGDLLANGRMENPFWKDNEDKALELMEYDYE
YTMQFDCPEDILDKDRILLHFDGLDTIADVFLNGEHLGDAFNMHRIWEYDIREKVKPAEN
ELRVVLHSPNKYIREAFRECRTLGNDDTLEGFVHIRKAHYMFGWDWGAHLPDAGIFRPVT
LLGIDRGRIDNVLILQQHERVPEADSDRAIAALGNRSVSRVTLQLQVTEETAGITDGVPK
LMDVTGGRVFGGCGQHMSYQAEITAPDGTKAVYEDSPTEIVIEEPKLWWPNGYGAQDLYT
IKVVLYSDGREIDCWEKRIGLRTMNMRREKDEWGECFAHEVNGAAVFAMGADYIPEDNLL
GRVTPETTRKLLEKARFANFNAIRVWGGGYYPSDWFYDICDELGLMVWQDFMFACAVYEL
TPAFEANIRQEFIENVKRIRHHASLGLWCGNNEMEQFVFERNSWLTKASEVRDYFLMFER
IIPEIVHTYDPQTFYWPASPSSGGCLDEPNDPNRGDVHYWAVWHGNKPFSEYRKYFFRYA
SEFGFQAFPSLKTIETFTDDPEDYNAFSYICEKHQRQYSANGKIMGYMQQTYKYPSGFDT
FIYASQLLQADAIRYGVEHFRRSRGRCMGAIYWQLNDCWPVVSWSSIDYEGRLKALHYYA
KRFFAPLLLSCEEQGMMSAEANMNREHFEFEKSIRLNVANETMKDAQVTVRWALRTPDAQ
IVRSGEESLMVPALTSVWLDKILFPEAQLRTNYVSYEMEMDGEILSEGTVNFSYPKYFAY
MDPQLSCEAEGDVITVKAQAYAKSVEIRNEEDNLVLSDNFFDMNAGVKRVRVLEGNTDKL
MVRSVFDIK

Enzyme Prediction     

No EC number prediction in MGYG000002330_01868.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	739	3.2e-102	0.6861702127659575

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.34e-99	22	670	27	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	1.25e-12	694	777	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10340	ebgA	1.08e-11	61	453	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	8.71e-10	261	322	48	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	1.39e-07	782	847	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU13790.1	0.0	1	849	1	823
QQQ93614.1	0.0	1	849	1	823
ASU28856.1	0.0	1	849	1	823
ANU76049.1	0.0	1	849	1	823
QMW80334.1	0.0	8	849	32	841

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	1.05e-152	1	826	3	825	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.08e-152	1	826	3	825	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	7.72e-152	1	826	1	823	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	7.93e-152	1	826	3	825	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	1.74e-145	6	829	11	812	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	6.24e-111	3	835	6	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q5B7W2	1.75e-109	2	835	5	828	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A2QYN2	3.50e-109	5	832	8	828	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
A1CGA8	5.15e-108	6	835	9	830	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
A1D911	7.76e-105	6	826	9	821	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_01868.