CAZyme Information: MGYG000002330_02006

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_02006
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000002330_68|CGC1	36541.46	4.7029

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 15; End: 986 Strand: +

Full Sequence      

MGEAWLATHIWEHYLYTGDEAFLREHFDVLEQCVTFFYDFLIEDEEGNLVTSPSMSPENT
YERADGTYGVLCESAVMDTEILMELFSCYINACRVLALDEEKARKAACVMERFPKLKIGR
HGQLMEWMEDYAEPEPGHRHISHVYGVYPGSSISYEKTGELMDAAKVTLERRLANGGGHT
GWSRAWIIGLWAHFREGRKAYENLQAILTMGTYPNLMDNHPLGEHDYVFQIDGNLGASAA
VLEMLAYSRPDRLELLPAVTAETAGGRLRGMGLRSGGTLDMEWKDGKVLWYRIMPGRDTE
LVICVNGKTEEVKLQDGVEYCGK

Enzyme Prediction     

No EC number prediction in MGYG000002330_02006.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	1	312	1e-108	0.41412742382271467

CDD Domains     

MGYG000002330_02006 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ96615.1	5.19e-124	1	308	425	733
BCJ93960.1	3.88e-98	1	302	431	728
ANW97613.1	1.05e-96	1	289	438	720
AGC67127.1	1.05e-96	1	289	438	720
ANX00173.1	1.05e-96	1	289	438	720

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KMQ_A	1.45e-56	1	309	464	763	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2RDY_A	2.34e-56	2	294	449	743	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
4UFC_A	1.63e-54	2	285	444	723	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
2EAB_A	1.52e-24	5	317	510	864	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	2.76e-24	5	317	510	864	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	6.36e-55	1	317	505	826	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	2.05e-28	4	289	465	762	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	2.15e-25	4	306	484	800	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	1.73e-17	47	283	446	694	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_02006.