CAZyme Information: MGYG000002330_02213

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_02213
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	MGYG000002330_72|CGC1	38061.24	4.8836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 10573; End: 11565 Strand: +

Full Sequence      

MKTAKIAPVPSRHPSQGQIEQIKRRFGLFLHFGVNTFGNVEWSDGSIPAQAYCPEQIDAE
QWVRAACEAGMNFVVLVTKHHDGFCMWDTDTTKYSVKYSGNPTDVVEKTAQACRKYGIKL
GLYYSLWDRNAPQYKEDFDSGYIPYMLEQLTELMDGRYGEIVELWLDGQWDKTRRQWQLD
RIYDLVKRLQPGCQIGVNGTVGADNDKASMPDEEYLPAKCRQGDPLCMFPSDFRLWDPHP
CRKGDPKIYTFEGKEYYLPFEMTICSREGDSWFYKDTYEKAPLKDAEETAALCRMVFEEE
NIVVINLPPDKKGKLVEADVTRLMEIADKL

Enzyme Prediction     

No EC number prediction in MGYG000002330_02213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	24	328	1.7e-62	0.8294797687861272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	4.06e-41	5	330	3	312	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	1.53e-37	25	328	26	326	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	2.94e-37	25	328	27	328	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOD59462.1	5.14e-111	6	330	24	345
QCQ35196.1	3.46e-110	6	330	24	345
QTO26593.1	3.46e-110	6	330	24	345
QCQ30777.1	3.46e-110	6	330	24	345
QRO24265.1	6.30e-110	6	330	26	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	5.43e-51	4	328	28	350	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
5K9H_A	2.13e-38	14	322	39	344	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
6ORG_A	1.02e-37	14	327	11	316	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
3UES_A	1.49e-37	14	323	19	340	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
6OR4_A	9.96e-37	14	327	11	316	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	6.65e-41	6	328	34	338	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	5.42e-39	6	328	36	339	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P10901	2.84e-15	14	330	32	353	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q99KR8	1.08e-11	12	177	37	232	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
P49713	2.01e-11	49	219	89	267	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000015	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_02213.