CAZyme Information: MGYG000002330_02214

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_02214
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829	MGYG000002330_72|CGC1	96393.9	4.8142

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 11635; End: 14124 Strand: +

Full Sequence      

MTRQNAQMGARMRKLILNDGWKMKEVSWEEYLDAEVPGSVYTDLMANGRMQDPFYRDNEK
EALAVIEHDYEYRTVFDADTELLACDEVLLCFDGIDTLSTILLNGSFLGNTDNMHRTWEF
NVKDMLREQENELRVILHSPTKFIADSYAKEPIEGCVDAMKGLPRLRKAHCMFGWDWGPR
IPDAGIFREASLKGVNRARIESVYITQKHEDGRVTLGLKADILPAERSDIRVKQAASDYR
VTLITPQKEKTVYEGSPEQILIREPQIWWPAGYGEQPLYTVRVELLEEETVLDSWERRIG
LRTMTVSREKDQYGEAFAHEVNGVRIFAMGADYIPEDNLLSRVTRERTRRLLQSAKDAHF
NTVRVWGGGYYPDDFFYDICDELGLIVWQDFMFACCVYDLTESFEETITAEFEDNIRRIR
HHACLGLWCGNNEMEMFIAENREGWCRNPVQFSDYIKMFEYIIPKVLKECDPQTFYWPAS
PSSGGGFDEPNDENRGDVHYWDVWHGGKPITEYRKFFFRYVSEFGFQSFPSLKTVETFTE
PRDRNIFSYVMEKHQRNSSANGKIMNYMEQTFLYPNDFDTTLYASQLLQAEAMRYGVEHF
RRNRGRCMGSIIWQLNDCWPAASWSSIDYFGRWKALHYFEKRFFAPLLLSCSEESTLTQD
PNVNAQPYELHKSITLCASNETLMEKQVGISWELRDAGAGILRSGNYEISLPPLSSVWMD
KVDLPEADIYENYVSYRMEENGNVCSRGTVLFCAPKYFHFRAPGLRVEREGDELVITVGC
YARSIRILNGEDNLRLEDNYFDMDAGVRRVKILEGKPEGLQVKSVYDIR

Enzyme Prediction     

No EC number prediction in MGYG000002330_02214.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	720	1.1e-107	0.7007978723404256

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.79e-95	11	689	8	679	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	1.65e-11	198	302	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	1.75e-11	72	433	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	4.98e-09	674	757	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10150	PRK10150	1.20e-04	240	306	216	280	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE97789.1	0.0	12	829	15	837
QIB54534.1	0.0	12	829	1	823
QMW79049.1	0.0	12	829	1	823
QJU13790.1	0.0	12	829	1	823
QQQ93614.1	0.0	12	829	1	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	4.97e-155	10	829	1	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	5.10e-155	10	829	1	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	3.75e-154	10	829	1	848	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	5.13e-154	12	829	1	846	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	7.73e-153	15	813	9	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CGA8	3.71e-113	10	826	2	842	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q5B7W2	1.89e-112	16	815	8	828	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
B8NW36	1.07e-110	17	819	9	833	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q2TXB7	7.94e-110	17	819	9	833	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
Q4WAH4	8.12e-110	10	826	2	842	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_02214.