CAZyme Information: MGYG000002330_02255

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_02255
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	MGYG000002330_72|CGC2	66345.49	4.889

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 66192; End: 67940 Strand: +

Full Sequence      

MPRTNDESYLSCVKRYYERVFMEVRGLLHKDGGPVIGVQIENEYGHCGGLTGEEGEDHMR
RLKRLAVGAGFDVPYYTATGWGGAVTGGMLPVLGGYCDAPWDPRITELEPSVNYVFTQER
NDRNIGSDLGMGEGLTWPWDKFPYLTAELGGGIQVTRHRRPVAAAADIGAMTLTKLGCGA
NLLGYYMYHGGTNPHGKRSTLQESRESGYPNDLPEYSYDFNAPIREYGQISDTGLELKLY
AMFLHDFGEAFCEMKTFIPEDSPQDPNDTVRLRSAVRRKGNSGYLFVNNYQRRKQMADHQ
GVILNVRLPDGDISYEAQDIRNGDYFFYPFHLPVGEHAVLISASASPLCILHRTDGERYI
FYGDREPHFRIEGDLGKKELIHISREDALHAWRMEFGTEEYLAVCNYPIVEEGGSCKVLF
RAGETEELEIRVYPELPTVPRGFVKTGNEGIFTRYSQRISRNTPSCNLQKEEKQSSDEEC
RYRIELDYAEETEAEDVFLKLDYVGESLELFIDGKKEGDHFYTGQIWEIGLKRFGFPENV
DITVHRLKRDMPVYLEQWPDLPEEGACRIHRLTAEAEYKLLF

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	2	238	7.5e-41	0.6384364820846905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	7.54e-17	3	239	109	313	Glycosyl hydrolases family 35.
PLN03059	PLN03059	3.43e-11	3	232	144	329	beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADZ82426.1	2.21e-212	3	579	119	686
QEH68119.1	4.30e-212	3	579	119	686
BCJ96076.1	1.09e-209	3	577	119	682
ACZ98631.1	1.16e-206	3	578	119	682
BCN30566.1	1.12e-201	2	579	120	684

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4E8C_A	1.60e-06	3	238	116	323	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
3W5F_A	1.74e-06	3	232	122	307	ChainA, Beta-galactosidase [Solanum lycopersicum],3W5F_B Chain B, Beta-galactosidase [Solanum lycopersicum],3W5G_A Chain A, Beta-galactosidase [Solanum lycopersicum],3W5G_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK5_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK5_B Chain B, Beta-galactosidase [Solanum lycopersicum]
6IK6_A	9.06e-06	3	232	122	307	ChainA, Beta-galactosidase [Solanum lycopersicum],6IK6_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK7_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK7_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK8_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK8_B Chain B, Beta-galactosidase [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9SCV9	3.46e-12	3	230	147	330	Beta-galactosidase 3 OS=Arabidopsis thaliana OX=3702 GN=BGAL3 PE=2 SV=1
Q93Z24	5.34e-12	3	232	178	383	Beta-galactosidase 17 OS=Arabidopsis thaliana OX=3702 GN=BGAL17 PE=2 SV=1
Q0DGD7	2.54e-10	3	233	149	355	Beta-galactosidase 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0539400 PE=2 SV=1
Q10NX8	1.51e-09	3	230	147	330	Beta-galactosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0255100 PE=1 SV=2
P48980	4.50e-09	3	230	138	321	Beta-galactosidase OS=Solanum lycopersicum OX=4081 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_02255.