CAZyme Information: MGYG000002330_02670

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_02670
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000002330_90|CGC1	42739.82	4.6955

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 25664; End: 26770 Strand: +

Full Sequence      

MDKIRGVNLGNWLVLEKWMHPALFEGTSAEDEDELCRQLPREELVKRLTAHRDSYITKED
FSYIRSCGLNTVRIPVPHFIFGDDPVYCEPYVPCIEYLDKAFDWAEETGLSILIDLHTAP
ESQNGFDNGGICGVCKWAQDPEKVDRVLKVLEMLALRYGSRPSLWGIQLLNEPISESLWQ
MIRGKYLPHNPERAAGSSFVPLEVLYDFYTRGYHMLREILPAEKKIVFHDGFRFEVWEPF
FREAGFENVVLDAHWYLGMGIADEDTSELEYMREILKEDVKKLKNMEKTVPVIVGEWCLA
HNLKPDKEYTELEKQLSYKLIGDAQLMAWEAGSGYFFWSYKLISEPDGWDFRKCVEKGWL
PGNLESGR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	51	341	2.8e-108	0.9933774834437086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.94e-27	1	202	15	231	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	2.09e-06	51	340	20	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS79423.1	8.53e-138	1	363	1	369
QRT49144.1	1.08e-127	3	361	2	386
AWY98291.1	4.78e-125	4	366	3	393
QBE98393.1	6.13e-125	4	361	3	386
QMW78416.1	1.23e-124	4	361	3	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	2.48e-110	3	364	2	390	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	2.00e-109	3	364	2	390	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
2PC8_A	1.06e-36	4	361	15	385	ChainA, Hypothetical protein XOG1 [Candida albicans]
4M80_A	1.45e-36	4	361	14	384	Thestructure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
1CZ1_A	1.84e-36	4	361	9	379	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7Z9L3	2.27e-49	2	361	29	393	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
B8N151	2.27e-49	2	361	29	393	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q0CR35	1.17e-47	2	366	38	408	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
Q96V64	2.93e-46	2	366	35	409	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
Q8NKF9	5.60e-46	2	366	35	416	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_02670.