CAZyme Information: MGYG000002330_04977

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_04977
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	MGYG000002330_146|CGC1	46363.95	4.1178

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 56411; End: 57673 Strand: +

Full Sequence      

MAKKLHAAQTTDSPYAGGLKISITSTLGQIPIEGATVSIALTESPDVILDTLTTDASGQT
DVVELPAPPLDYSLSPSEQRPYSEYNITVEAPGYEPVVVEGSEILPDVLSLQPVALIPEA
VPGQEEDIVIPDHTLYGDYPPKIPEAEIKPVDETGEIVLSRVVIPEYVVVHDGVPTDSSA
PNYYVRYTDYIKNVASSEIYATWPESTIYANILAIMSFTLNRVYTEWYRNQGYNFTITSS
TAFDQKWIYGRNIYENISYLVDTIFANYLSRPGVRQPILTSYCDGRRVNCSGLSQWGSKY
LGDEGYSAMEIIHYYYGSDMYINTADAISGIPSSWPGYTLTIGSSGAKVLQMQEQLNRIS
QNYPAIPYVAADGVYGQQTADAVKVFQRVFGLPQTGAVDYPTWYEISRIFVGVSRIAEPD

Enzyme Prediction     

No EC number prediction in MGYG000002330_04977.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	1.71e-12	345	403	1	54	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	3.46e-07	339	403	38	99	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	1.91e-04	336	408	117	185	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
pfam13620	CarboxypepD_reg	7.60e-04	23	101	6	66	Carboxypeptidase regulatory-like domain.
TIGR02669	SpoIID_LytB	0.002	292	316	236	260	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASM69598.1	9.77e-194	11	418	11	419
AWY98201.1	3.23e-192	5	418	6	419
QEI32542.1	6.32e-192	17	418	24	428
QHB25032.1	6.32e-192	17	418	24	428
QRT31086.1	9.64e-192	17	418	26	430

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_04977.