CAZyme Information: MGYG000002330_05511

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_05511
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
905	MGYG000002330_166|CGC1	103359.13	5.3181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 5533; End: 8250 Strand: -

Full Sequence      

MKAIHLMCNNFSNPIQVEENPVFSWNIPCDRNGAGQTAYRIQVYCGKEKCWDTGRTEGDS
CLFIPYDGRTLIPDSQYSWRVKYWNERGEEAEWSEPAFFETGLMENGWKAEWIGYDRIEG
EAYNPAITFYCADDFDKGINQYYLPPAPYIRKEFIVKEGLRSAKLYISALGLTEIEINGN
KAGDEVFIPGLSDYDRTVYSRAFHVEDFLDEGSNAIGIILADGWYAGYIGLNAREWYGSR
PRVILQLEMEYQDGVREQIMSDASWKASYGPLQESDIFQGETYNALKELGKWSSPGYQDE
RWEAVDTGTEKRLIPKGHTGVAMKERESLRPAKIIRKRENCYLIDFGEYLAGVMEISCTG
EAGASFSVKHAETLDKNGELYLRGNRSARCMDSYILKGAQTEYFKPRFTYHGFRYAEICG
KGKVSFLDIKALKIGSELPDKTEFSCSSELVNQIFEMIRSTEECNMMDVPTDCCARDERL
GWGMEGNHFMHAMAYMNNQSAAISKWVKDIWDGQREDGGLEAIAPPMRMKDIEQFVGDLQ
SNHGVHMVYVLYRMYGDTHVIRKYFNQMNRYFDFLERNSDRYIRNATGGDWLAILEETNH
SDFLHGFGDSSPGMIGTSHYAIITQMMAEMCHAIGKQADEQRYLKLLGNIKNAFRLNYIQ
RDGTLRNGRQGEYLMALYCGFFTEEEEKKALIVLEKKLMEKGHIQWKGGTATTPYFLTAM
KRFGKEKLANLFLTSDQYPGLGYMLHCGYHTIWERWDAVFEDGTLHPQAMNALCHIGFTV
VAQYLIGGLAGIDCLEAGFRKIVISPGPSEEIRSACAKLFSNYGVIKSAWKWENGILHVK
CSIPANTKAIIVLPRNQTEELLWLEGESMGTVYNNNKVFAEISSGKYEMEIRWDGDNPMS
VRERS

Enzyme Prediction     

No EC number prediction in MGYG000002330_05511.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	335	853	2.4e-118	0.996031746031746
CBM67	147	306	4.2e-29	0.8522727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.81e-66	439	785	1	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.25e-50	160	305	3	150	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.08e-25	335	434	1	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.85e-13	791	855	1	65	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SOE23203.1	8.88e-172	21	886	49	896
QCX01370.1	2.62e-171	11	892	41	922
ASO06560.1	1.54e-169	21	892	49	919
QDH81299.1	2.90e-161	5	887	30	915
AIE86284.1	6.63e-161	1	892	1	873

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.67e-128	6	887	35	937	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.07e-128	20	892	24	1031	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.11e-92	18	861	20	854	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.67e-127	20	891	24	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	3.49e-125	2	893	34	924	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	4.87e-100	11	854	40	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	6.38e-99	6	889	35	947	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_05511.