CAZyme Information: MGYG000002330_05567

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_05567
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000002330_169|CGC1	42366.38	4.5972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 31045; End: 32136 Strand: -

Full Sequence      

MLQEVDRKLRQLIGAFTSILYEDDDIFMEKMRRKKNLSEEELQKYAHWEWTQGVGLYGIW
KLFAASGEKEYLEILTRYYDRQQQVGFPQCNVNTVTPYLTMSYLAEYLQSEVYMKPCQEA
AEWVMYQMPRTREGGIQHMTSDDVNEQELWDDTLVMTVLFLANMGRILDREDYRNEAQYQ
FMVHMKYLQDPKSGFWYHGWTFLERNHFAGAFWGRGNCWITIAIPELLSSIPCSEPVERI
LKEALCNQVEALAECQAESGMWHTLLDDPESYEEASATCGFAYGILRGVHCGLLEEKWLE
AAERVLKPVLALISEEGVLGQVSYGTPMGRENREFYKEIPLRPMPYGQALAILFLVEWKK
GYT

Enzyme Prediction     

No EC number prediction in MGYG000002330_05567.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	41	359	9.9e-98	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	7.82e-105	23	357	12	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.19e-95	24	357	3	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR00386.1	1.34e-158	4	360	7	362
ANU44854.1	1.34e-158	4	360	7	362
QEH70918.1	1.62e-156	3	357	4	357
SET92327.1	1.57e-155	2	360	1	358
BCJ96760.1	1.09e-152	4	357	8	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.05e-94	8	362	25	380	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.16e-94	45	362	63	381	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	3.43e-88	4	362	7	372	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	2.13e-22	40	298	31	300	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.06e-22	40	298	21	290	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.49e-63	48	357	29	334	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	1.17e-21	40	298	31	300	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	2.33e-11	150	324	201	380	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_05567.