CAZyme Information: MGYG000002330_05649

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_05649
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	MGYG000002330_172|CGC3	28059.01	5.0565

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 52683; End: 53423 Strand: -

Full Sequence      

MRFIKKFIITLIVILLLGAGAAGGRLLWQGYQIYQEVIDGEPLSDKVEEIRSKPKYTPLS
QLPDTYKNAVVAVEDKRFYKHGGIDLISTGRAVFINLKEKKLAEGGSSITQQLAKNMYFS
QEKTFLRKVAELFVAFELEKNYTKDEILELYVNTIYFGSGYYCVHDAAQGYFEKEPEQMN
DYESTLLAGIPNAPSVYALTNRPELAVQRQRTVVECMVDQKYLTREEADRILQEGEQIQQ
AGQNNE

Enzyme Prediction     

No EC number prediction in MGYG000002330_05649.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	51	217	2.5e-60	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	4.55e-77	39	218	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.27e-73	56	234	4	182	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.39e-66	56	243	78	266	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.69e-66	32	234	50	247	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	2.92e-51	45	234	36	231	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO38940.1	2.49e-85	1	233	1	233
QNM09777.1	5.31e-82	29	232	38	241
QRP41835.1	5.98e-82	29	228	28	227
ASN93505.1	5.98e-82	29	228	28	227
QJU22158.1	1.96e-80	29	228	28	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	2.35e-42	56	227	22	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	9.34e-42	56	227	22	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	4.07e-39	45	223	48	232	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	4.21e-39	45	223	12	196	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	4.33e-39	45	223	13	197	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07259	1.75e-43	42	234	35	226	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
P38050	4.54e-42	59	228	72	241	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O87579	1.48e-40	55	234	69	248	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
O86088	2.02e-40	39	234	56	248	Penicillin-binding protein 1A OS=Neisseria cinerea OX=483 GN=mrcA PE=3 SV=1
P0A0Z6	2.76e-40	39	234	56	248	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.900124	0.084067	0.013280	0.000454	0.000256	0.001831

TMHMM  Annotations     

start	end
7	29