CAZyme Information: MGYG000002330_06005

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_06005
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664	MGYG000002330_185|CGC2	76404.7	5.0635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 15289; End: 17283 Strand: -

Full Sequence      

MNLKKTLQEPMRRRQTRKYEERISSQTVAYHDWILKKEKAEREGSALLGQELSIEYIAYS
GCGEAFSLKDADADLTVFYGDGGKPEKEEMGLLADYFARHPQVLIAYGDEDEVDASSGEP
RRKNPWLKPDWSPDTLISYFYFGNIFAVRTAACREIPWLGSRDFRKNLYDFCLKAVEIKG
EAGHIDSVLFHNTCPICPFGMEEKYEDIKKEAYIRRGWPLKPEGMVSIVIPSKDNPGVLS
TCIHSILEASAYRNFEIIVIDNGSNEKNKERIHLMLSQMQEECRFRYIYEPMEFNFSAMC
NKGAALAKGDYILLLNDDIEIIQEDWLDKMLEKAMLPHVGAVGVKLLYPGSNTIQHAGIT
NIRLGPAHKLQFRDDRNDYYFLRNRLCFDVLGVTGACLMVKKSTYEAAGGLSETLRVAFN
DVELCYHLYDMGYVNVVRNDVALYHHESLSRGMDDSVEKLKRLHQELNMLYELHPSIYGQ
DPFYHRYLVRDVLDQEFYAGNRYEYTDRCDRAEPEALRDGLRPEWSNEVLRMGIEFAGDL
CKWETGKNGGGNYFIQGWCYALQVDNSQYHFNLLLKPVDRGDGPAEESGGEAGAVWKVPV
NRQYRPDIQENLGHMQMVALTGVCLQFDREALPEGEYLIGFLWEDCCSRQKLYQWTAETM
EIVH

Enzyme Prediction     

No EC number prediction in MGYG000002330_06005.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	227	402	6e-22	0.9529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	7.40e-31	228	447	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	9.01e-20	227	403	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	1.24e-19	225	452	4	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	2.88e-16	228	343	1	112	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	3.18e-15	227	441	1	189	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL33298.1	8.41e-125	14	662	13	702
AOZ95571.1	1.77e-123	3	662	2	701
QNM02107.1	1.59e-122	1	658	1	663
CBK92935.1	5.92e-101	100	648	168	697
QWT52131.1	2.76e-99	99	645	505	1040

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.90e-50	86	470	462	870	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	6.10e-42	23	454	342	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q57022	5.06e-06	225	339	5	114	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_06005.