CAZyme Information: MGYG000002331_00420

Basic Information

• Species: Vibrio parahaemolyticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio parahaemolyticus
• CAZyme ID: MGYG000002331_00420
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
802	MGYG000002331_3|CGC8	92243.93	4.7719

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002331	5262465	Isolate	Bangladesh	Asia

• Gene Location: Start: 423437; End: 425845 Strand: +

Full Sequence      

MAQIELNGTWQLTSPQRPDIDIPMNLPGDNVSALLQAELIPNPYFADNEAKVRWIEECDW
HIERQFEVGDSTLCASHIWMTLTRVDTLAQFFINGERVLTSSNMFAQQRVDIKPYLKQGT
NTIRVEFARVDLEGIARAKKLPFPIPSAMGNNQIPHMNLIRKTQCHSGWDWGICLMVSGI
YDPIQIDVVTDIWLKNVSTEQQWQADGSVILDVLVEVQTDNPSHHVTVEFDGEVQFIQTE
GSGHYHCQFHVQKPQLWWPAGYGDAHLYTISVGCSEQTLSRKIGLRQLSLNSQEDEHGSA
MEFIVNGTPINAKGANWIPVDAMPGRECERRYRDLLQSAVDANMNMIRVWGGGQYESETF
YNLCDELGLLVWQDMMFACSLYPSNDEFLKDVEEELRFQIPRLKAHPSIALWCGDNEVIG
AIGWYDESKHNKVKYTVNYDRLNRMIEQVITQQDDSRRFWPSSPCNGELDFGDAWHDDSK
GDMHFWDVWHSGKSFSAYLNINPRFCSEFGFQSWPSFAEVKQFVPERDWNITSPTFEQHQ
KNPRGNSIITEMFTRYFRFPSGFEQMLYLSQVQQAMAIKTACDHWRAISPICRGMLYWQL
NDNWPVSSWSSLEYSGRWKQLHYHAKRFFAPQYLVFSEHTGKLSLHLLNDAKDPASVSAQ
LKWVDWQGEEKQCWSLEQTVIADSNTILWQLDESFEKDELTSGFLYVEAQIGEDRISNTW
FCTHELKTLPMAKANIDVSIEGSQITLVADKPAFFVHVECDTQGRFSDSSLTLLANQPVT
IEFLGDDLVAMSASLRVYHLMQ

Enzyme Prediction     

No EC number prediction in MGYG000002331_00420.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	714	6.4e-94	0.723404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.36e-118	3	638	12	638	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	4.04e-11	733	801	1	77	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	2.63e-08	641	722	1	87	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	2.16e-07	194	286	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	4.49e-05	249	417	278	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQD05712.1	0.0	1	802	1	802
QLE32864.1	0.0	1	802	1	802
QUD95233.1	0.0	1	802	1	802
APU75614.1	0.0	1	802	1	802
ANZ11941.1	0.0	1	802	1	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	7.50e-131	1	781	3	830	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	7.69e-131	1	781	3	830	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	5.43e-130	1	781	1	828	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	5.57e-130	1	781	3	830	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	6.26e-128	22	777	26	810	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4FZV0	9.93e-108	6	777	25	852	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
Q29444	5.03e-107	1	673	20	732	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q95327	7.02e-107	1	783	20	855	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
O00462	7.57e-104	6	783	25	855	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3
Q8K2I4	2.05e-103	6	774	25	847	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002331_00420.