CAZyme Information: MGYG000002331_00451

Basic Information

• Species: Vibrio parahaemolyticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio parahaemolyticus
• CAZyme ID: MGYG000002331_00451
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
959	MGYG000002331_3|CGC9	106078.27	4.4568

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002331	5262465	Isolate	Bangladesh	Asia

• Gene Location: Start: 457657; End: 460536 Strand: +

Full Sequence      

MKPSFIALAVASCISLAGCGSDSSDAPVPVDKPIISADLYLRGLNGGWGTAEHAKLNYLG
NNEYETVLRVARGSNQFKIADPGWQIQYTYFEEPAAFDKAQEYLPKPDTNEACMNDDCNS
EITFEDKGYYKFSVSFADESRATMTVTKATQEEAEKYYSDAILDPAMVHEGHLSKEVKLF
ANYDDSNDTVIFSVKDPKAELREFGISTTTELRDALDQGLVINEQTGPRVVSGDVAFDAL
FALTMKELDQLAVSEIKDGNYNYNNPIKAEVFETGAKWHYVWTRDLAYAADLSLALMNPT
RVQNGLNFKLSAFRDTTDQQYDGEQIVQDTGTGGSWPISTDRTTWALGAERLLSALDGEE
YNQFAERAYKAISNTLEADRLAAFDAKSGLYTGEQSFLDWREQTYSTWTPNDVNAIGSSK
ALSTNVVHYRAIQLAAKLAEKYDSTNAVKYTEWAAQLKTAINDQFWNAARGMYVSYLFDN
GKDIAVDKYDMLGEALAIISGVASDAQAKQIMANYPHSEFGVPVYFPQQPDVPVYHNRAI
WPFVTAYSLRAAHQTQNVAAANNAIQSLVRGTATNLSNMENLEWLSGKSFIIHSDHGEAP
SLDGPVINSQRQLWSVGGYLNMVVETLFGIHTETGKLEVKPFITSWVRNKLLAQSEQITL
ENFAFKGKNYSVTIDLPEVSKDETGYYPVENVTMDEEGHFHVTLGALVNVDSSITLVSGV
KPYVSEDSRVYSPQEPTLVVKSVDNSVSIDVTSKYNVNLYRNGELIQKNVIAQSYSDTPT
GFACYLAESINDKGFRSNPSQPVCVGEEIRIKLDGEYQPLKDNVSVVTVSKDSGIVKGAE
SFTAPVTGTYQFDAWYNNNLGQLNTGITNTVKLLEVLDDAGKVVGQGYLQMGHIGENQGM
RYSTPIEVALEQGKTYQIALKDHFNMSYLTSNETYIYAGGIEGEKNEAQIADIRITPLM

Enzyme Prediction     

No EC number prediction in MGYG000002331_00451.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06202	GDE_C	2.98e-09	332	617	73	370	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
cd02861	E_set_pullulanase_like	1.09e-07	22	84	1	56	Early set domain associated with the catalytic domain of pullulanase-like proteins. E or "early" set domains are associated with the catalytic domain of pullulanase at either the N-terminal or C-terminal end, and in a few instances at both ends. Pullulanase (also called dextrinase or alpha-dextrin endo-1,6-alpha glucosidase) is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. The E set domain of pullulanase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, isoamylase, and the beta subunit of AMP-activated protein kinase.
pfam17389	Bac_rhamnosid6H	2.36e-04	391	475	124	223	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG4354	COG4354	0.001	363	523	462	626	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBQ36601.1	6.27e-205	190	957	40	818
AVR98316.1	7.53e-189	228	957	76	815
QCP11581.1	1.68e-188	188	955	35	828
AQT69211.1	2.89e-163	183	958	35	840
AKT39344.1	1.13e-150	194	958	99	896

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000060	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002331_00451.