CAZyme Information: MGYG000002331_02111

Basic Information

• Species: Vibrio parahaemolyticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio parahaemolyticus
• CAZyme ID: MGYG000002331_02111
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000002331_4|CGC3	43749.72	9.6311

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002331	5262465	Isolate	Bangladesh	Asia

• Gene Location: Start: 449524; End: 450663 Strand: -

Full Sequence      

MKKIAFIATALLLAGCSREFVEKIYDVNYEPTNRFANNLAELPGQFEKDTAALDALINSF
SGNIKKRWGQREVKFAGKSNYVKYIDNYLSRAEVDFQKGLITIETVSPTEPQKHLKNAII
TTLLTPDDPANVDLFSSKEIKLEGQPFLYKQVLDQDKKPIQWSWRANRFADYLIANNIKT
KDVDFKKAYYVEIPMVEDHFSQRSYQYADIVRRASKKYDIPEDLIYAIIKTESSFNPYAV
SWANAYGLMQVVPKTAGRDVFKLVKNKSGQPSPEYLFNPENNIDTGTAYFYILKNRYLRE
VQHPTSLEYSMISAYNGGTGGVLNTFNRSDRKRAMRDLNSLHPNQVYWALTKKHPNAEAR
RYLEKVTNFKKEFNSEHTL

Enzyme Prediction     

No EC number prediction in MGYG000002331_02111.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	222	376	2.7e-24	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11671	mltC	3.06e-154	1	373	1	356	membrane-bound lytic murein transglycosylase MltC.
cd16893	LT_MltC_MltE	3.50e-97	209	371	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
pfam11873	DUF3393	8.82e-93	46	206	1	161	Domain of unknown function (DUF3393). This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is typically between 188 to 206 amino acids in length. This domain is found associated with pfam01464.
COG0741	MltE	2.69e-45	88	371	18	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
PRK15470	emtA	1.68e-39	192	366	30	196	membrane-bound lytic murein transglycosylase EmtA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGG32572.1	2.60e-279	1	379	1	379
APE83002.1	2.60e-279	1	379	1	379
ALG50722.1	2.60e-279	1	379	1	379
ASZ51081.1	2.60e-279	1	379	1	379
ANZ11158.1	2.60e-279	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	1.98e-105	48	373	14	338	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	5.62e-105	48	373	14	338	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
6GI4_B	1.58e-29	202	366	17	179	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]
2Y8P_A	4.28e-29	202	366	17	179	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	5.41e-29	202	366	34	196	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7N7I2	1.26e-112	36	371	19	353	Membrane-bound lytic murein transglycosylase C OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=mltC PE=3 SV=1
Q666M2	9.71e-110	1	373	1	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=mltC PE=3 SV=2
A9R6R2	9.71e-110	1	373	1	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Angola) OX=349746 GN=mltC PE=3 SV=1
B2K0V2	9.71e-110	1	373	1	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=mltC PE=3 SV=1
Q1CEV1	9.71e-110	1	373	1	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000060	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002331_02111.