CAZyme Information: MGYG000002331_02341

Basic Information

• Species: Vibrio parahaemolyticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio parahaemolyticus
• CAZyme ID: MGYG000002331_02341
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1032	MGYG000002331_4|CGC7	118904.4	4.9208

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002331	5262465	Isolate	Bangladesh	Asia

• Gene Location: Start: 695701; End: 698799 Strand: -

Full Sequence      

MNNWENFQHLHENRMAPRAYFFSYDSVQSAQTFQRELSRRFMLLSGQWTFRYFTNPMLVP
DEFYSQTMNDWGHITVPNMWQMEGHGDLQYTDEGFPFPIDVPFVPTDNPTGAYQRTFTLG
PQWDNQQTIIKFDGVETYFEVYVNGEYVGFSKGSRLTAEFDISAYAHQGENLLSVRVMQW
ADSTYIEDQDMWWTAGIFRDVYLVGKEAVHVQDLTIRTDFADDYQSATLSAQVELENLST
AIASGYTLEYALHDKGTVVASGQCDSLTIQNHHSTSFAIDMVNPTHWTAENPYFYHLFIT
LKDHQGNVVEVIPQRVGFRDIKVRDGLFYINNQYVMLHGVNRHDNDHLKGRAVGMDRVEK
DLILMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVETHGFANVGDLSRITNDPA
WEAVFVDRVVRHVHAQKNHPSIIMWSLGNESGYGCNIRAMYAATKALDDTRLVHYEEDRD
AEVVDVISTMYSRAQLMNYFGEHPHEKPRIICEYAHAMGNGPGGLTEYQNVFYAHDHIQG
HYVWEWCDHGILARDEHGQEFYKYGGDYGDYPNNYNFCMDGLIYPDQTPGPGLKEYKQVI
APVKIRAVEGCHDRFIVENKLWFTNLDDYTITADVRAEGKTLRSVQFKVEALVANSEREV
TIDLPELDEREAFVNFTVRKDSRTLYSEANHEIAVYQFQLKDNTATLPALVNHNVQPLVL
EESRLEHVITGHNFALTFSKVNGKLTSWRVNGEEIIQSEPRLNFFKPMIDNHKQEYEGLW
HPAHLQIMQEHFRTLSVEASEDAILITTSSIVAPPVFDFGMRCTYRYQINAQGHLNVELS
GERYGDYPHVIPVIGLDLGINGSFDQVSYYGRGPEENYQDSRQANLIDVYHSTVEDMFEN
YPFPQNNGNRQHVRWASLTNRHGTGLLVKPQQEINFSAWLYTNQNLHEAQHTIELEKSGY
ITLNLDHQVMGLGSNSWGSEVLDSYRVYMDEFRYGFTLMPLQAGDCNAQVMANHDFDNAF
FTQTNTQPVNEA

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	26	887	2.3e-211	0.9800531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	0.0	36	888	7	807	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	0.0	2	998	15	1024	beta-galactosidase.
PRK10340	ebgA	0.0	1	1022	1	1021	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	3.16e-138	321	605	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	1.16e-114	730	998	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APC88308.1	0.0	1	1032	1	1032
QEL39465.1	0.0	1	1032	1	1032
AVF95961.1	0.0	1	1032	1	1032
QQE15174.1	0.0	1	1032	1	1032
QET59413.1	0.0	1	1032	1	1032

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	3.09e-205	4	998	4	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	3.18e-205	4	998	5	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3OB8_A	3.92e-194	3	998	15	1029	Structureof the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
1JZ7_A	9.25e-172	4	994	16	1016	E.COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_B E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_C E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_D E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],4TTG_A Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_B Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_C Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_D Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli]
1PX3_A	1.30e-171	4	994	16	1016	ChainA, beta-galactosidase [Escherichia coli],1PX3_B Chain B, beta-galactosidase [Escherichia coli],1PX3_C Chain C, beta-galactosidase [Escherichia coli],1PX3_D Chain D, beta-galactosidase [Escherichia coli],1PX4_A Chain A, beta-galactosidase [Escherichia coli],1PX4_B Chain B, beta-galactosidase [Escherichia coli],1PX4_C Chain C, beta-galactosidase [Escherichia coli],1PX4_D Chain D, beta-galactosidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P06864	0.0	1	1022	1	1021	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
Q56307	1.74e-204	4	998	5	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	3.36e-200	4	1001	20	1034	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
P00723	1.76e-193	3	998	8	1022	Beta-galactosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=LAC4 PE=1 SV=2
A5F5U6	2.87e-183	4	998	13	1016	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002331_02341.