CAZyme Information: MGYG000002331_02436

Basic Information

• Species: Vibrio parahaemolyticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio parahaemolyticus
• CAZyme ID: MGYG000002331_02436
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		42733.87	6.7527

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002331	5262465	Isolate	Bangladesh	Asia

• Gene Location: Start: 802216; End: 803355 Strand: +

Full Sequence      

MEKPLRIGIIAGELSGDTLGEGFIKAVKERYPNAEFVGIGGPKMIAQGCESLFDMEELAV
MGLVEVLGRLPRLLKIKAELVKYFTQNPPDVFVGIDAPDFNLRLELDLKQAGIKTVHYVS
PSVWAWRQKRIFKIEAATNLVLAFLPFEKAFYDKFKVPCEFIGHTLADAIPLQSEQAPAR
DLLGLEQDKKWLAVLPGSRGSELKMLSQPFIETCKLLHQKYPGLGFVVALVNQKRREQFE
QAWKAHAPELDFKLVDDTARNVITASDAVMLASGTVALECMLLKRPMVVGYRVNTFTAFL
AKRLLKTKYVSLPNILADDELVKEYLQDDCTPDNLFNEVSRLLESDNKPMLDKFTEMHHW
IRKDADQQAANAVLKLIEK

Enzyme Prediction     

No EC number prediction in MGYG000002331_02436.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	7	362	3.1e-138	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	0.0	4	379	1	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.25e-180	4	379	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
TIGR00215	lpxB	2.03e-155	7	376	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam02684	LpxB	3.95e-150	7	373	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	8.08e-48	9	326	231	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLE30042.1	8.33e-276	1	379	1	379
QRH12097.1	8.33e-276	1	379	1	379
ARC19367.1	1.18e-275	1	379	1	379
AWJ77624.1	1.18e-275	1	379	1	379
APE83316.1	1.18e-275	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.86e-153	2	378	4	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.51e-152	2	378	4	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q87MF0	2.37e-276	1	379	1	379	Lipid-A-disaccharide synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=lpxB PE=3 SV=1
A7MY02	2.78e-259	1	379	1	379	Lipid-A-disaccharide synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) OX=1224742 GN=lpxB PE=3 SV=1
Q8DBE8	1.63e-249	3	379	4	380	Lipid-A-disaccharide synthase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=lpxB PE=3 SV=1
Q7MIH2	1.63e-249	3	379	4	380	Lipid-A-disaccharide synthase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lpxB PE=3 SV=1
C3LQ19	5.52e-227	1	379	1	379	Lipid-A-disaccharide synthase OS=Vibrio cholerae serotype O1 (strain M66-2) OX=579112 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002331_02436.