CAZyme Information: MGYG000002331_03679

Basic Information

• Species: Vibrio parahaemolyticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio parahaemolyticus
• CAZyme ID: MGYG000002331_03679
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000002331_4|CGC16	53988.68	4.8938

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002331	5262465	Isolate	Bangladesh	Asia

• Gene Location: Start: 2162233; End: 2163690 Strand: -

Full Sequence      

MATNNLSILFVASEVEGLIKSGGLADVAKALPEALQNLQQDVRITIPAYTSIERLADAEV
VLETNLTSWPHTKYRVLLLTLGNNPVYLIDCEPYFNRPSMYAENNQAYTDNGERFAFFSA
ACLDMLPKLAFQPDIIHANDWHTGLVPFLLKHRYGNDPFFAHTKSVISIHNAVFKGVFSY
DDVQCLPEFHCRNVPGAAVSATHITMLKAGVMNADKINAVSPTYAEELKTELGSHGMAWE
FQQRAGDLVGILNGCDYSAWNPETDVYLPMNYSADKQSMVLGKNTCKRALQQRLNLAEKD
VAMFGMVCRLTQQKGVHYLLPALADFLKHDVQVVVVGTGDPVLAAQLEEVAAQFSDKFVF
VEAYDNELAHLVEAGSDFFLMPSEFEPCGLNQIYSMAYGTLPIVRGVGGLKDSVNDYDVD
PCDATGFVFYEPTSQALLLTMLRALLLYAQNLTEVQRVQLHAMQKDFCWRKAAESYLQLY
RSALN

Enzyme Prediction     

No EC number prediction in MGYG000002331_03679.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	8	481	1.7e-159	0.9936440677966102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	6	483	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	6	485	1	465	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	8	482	2	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	8.63e-160	8	485	3	480	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	9.07e-102	6	482	4	478	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMG07864.2	0.0	1	485	1	485
AGB09476.1	0.0	1	485	1	485
AYO04976.1	0.0	1	485	1	485
BAC59287.1	0.0	1	485	1	485
ARC17723.1	0.0	1	485	1	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	4.52e-85	6	480	1	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	7.91e-85	6	480	1	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	6.14e-84	6	480	1	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
4HLN_A	2.77e-73	7	483	126	625	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
6GNF_A	5.13e-69	6	485	22	541	GranuleBound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_B Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_C Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q87QX5	0.0	1	485	1	485	Glycogen synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=glgA PE=3 SV=1
Q7MJ50	2.36e-300	1	484	1	484	Glycogen synthase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=glgA PE=3 SV=2
Q8DAR0	6.75e-300	1	484	1	484	Glycogen synthase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=glgA PE=3 SV=2
B7VM42	7.80e-257	1	483	1	483	Glycogen synthase OS=Vibrio atlanticus (strain LGP32) OX=575788 GN=glgA PE=3 SV=1
B6EQL7	3.71e-238	1	480	1	480	Glycogen synthase OS=Aliivibrio salmonicida (strain LFI1238) OX=316275 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000019	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002331_03679.