CAZyme Information: MGYG000002334_01616

Basic Information

• Species: Bifidobacterium thermophilum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium thermophilum
• CAZyme ID: MGYG000002334_01616
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749	MGYG000002334_1|CGC20	85653	9.449

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002334	2291643	Isolate	not provided	not provided

• Gene Location: Start: 2058656; End: 2060905 Strand: -

Full Sequence      

MRKTAEHKNVRHGRQWGAETSTRPLAIMHAKPSGMRIILGYVAMGATVISYTVYMVTMIL
TMFVNNPDITLRFVIEDVLYLVIVTTLIFSAMVYLVTRQGAMRRFLTHERVPRAVLDEHY
AHGYDKGITVLIPSYVEQPKVVAKTIWSAALQEFPDLAVVLLIDDPPHPKNDESRQILEA
CRSLVPSILDELARPAKRFTEHRNLATKALVGQVHARRSIVARCADDYRAAVRWLDAKAD
YWPIEDHTDEFFCDQVLRGLARDLRQTEDALNDAVNLHDPVPAERIVQLYNRLVWIFTVK
GWSFERKQYISLSQEGNKAMNLNSFIGLMGHRVKREETADGVVLRDVRPGEVPDFVMRDS
EYVLTLDADSMLLRDYCIRLVYQLEQPGNEHVAVIQTPYSSYRGAPTRIERIAAATTDIQ
HVLHQGMTYYDATFWVGANAVIRKRALDDICVVSTEGMRTVRTYIQDRTVIEDTESSVDL
GYYGWHLVNYPERLSYSSTPPDFGSLVVQRRRWANGGLLIIGKFFRIVRARRRQGNPVRL
GEWCLRVNYMASIAWSSFGLLFLLAYPFDQRLLSPWVVAASLPYFITYANDLKSNGYKRT
DIFRIYGFNIVLLTVNLAGTLKSIQQGMTNTKIPFVRTPKVSNRTASPPLYVAMPWAIVV
FSCFVLYADYLSANWGNAIFAGFNAVVTLWALVSYIGIWHSIQDMVVGLVRWFFVPVKQP
VKARKTDNPSWKDVLYFGDRKMIYESRPV

Enzyme Prediction     

No EC number prediction in MGYG000002334_01616.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	362	582	7.8e-28	0.9644670050761421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13632	Glyco_trans_2_3	9.23e-28	362	586	1	192	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
cd06421	CESA_CelA_like	3.49e-20	359	521	84	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	3.23e-12	359	588	137	355	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	1.22e-09	359	523	84	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
PRK14583	hmsR	5.14e-07	360	562	156	338	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGH41936.1	0.0	1	749	4	752
QTL81505.1	0.0	15	749	16	750
AZN75405.1	0.0	15	749	16	750
ALO75378.1	0.0	15	749	22	756
BAR04360.1	0.0	15	749	16	750

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.81e-08	360	516	227	374	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.88e-08	360	516	239	386	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.89e-08	360	516	240	387	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59167	1.63e-07	337	589	199	440	Cellulose synthase 2 OS=Komagataeibacter hansenii OX=436 GN=acsAII PE=3 SV=1
Q9WX61	2.68e-06	360	581	229	434	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
P0CW87	4.24e-06	359	589	228	442	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
Q76KJ8	4.24e-06	359	589	228	442	Cellulose synthase 1 OS=Komagataeibacter hansenii OX=436 GN=acsAB PE=1 SV=1
Q9RBJ2	9.56e-06	359	581	225	431	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999950	0.000046	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
37	59
74	96
545	567
572	589
602	621
645	667
680	702