CAZyme Information: MGYG000002337_00898

Basic Information

• Species: Staphylococcus aureus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
• CAZyme ID: MGYG000002337_00898
• CAZy Family: GH73
• CAZyme Description: Bifunctional autolysin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1256		137550.4	10.1015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002337	2749621	Isolate	not provided	not provided

• Gene Location: Start: 979045; End: 982815 Strand: -

Full Sequence      

MAKKFNYKLPSMVALTLVGSAVTAHQVQAAETTQDQTTNKNVLDSNKVKATTEQAKAEVK
NPTQNISGTQVYQDPAIVQPKTANNKTGNAQVSQKVDTAQVNGDTRANQSATTNNTQPVA
KSTSTTAPKTNTNVTNAGYSLVDDEDDNSENQINPELIKSAAKPAALETQYKTAAPKAAT
TSAPKAKTEATPKVTTFSASAQPRSVAATPKTSLPKYKPQVNSSINDYIRKNNLKAPKIE
EDYTSYFPKYAYRNGVGRPEGIVVHDTANDRSTINGEISYMKNNYQNAFVHAFVDGDRII
ETAPTDYLSWGVGAVGNPRFINVEIVHTHDYASFARSMNNYADYVATQLQYYGLKPDSAE
YDGNGTVWTHYAVSKYLGGTDHADPHGYLRSHNYSYDQLYDLINEKYLIKMGKVAPWRTQ
STTTPTTPSKPTTPSKPSTGKLTVAANNGVAQIKPTNSGLYTTVYDKTGKATNEVQKTFA
VSKTATLGNQKFYLVQDYNSGNKFGWVKEGDVVYNTAKSPVNVNQSYSIKPGTKLYTVPW
GTSKQVAGSVSGSGNQTFKASKQQQIDKSIYLYGSVNGKSGWVSKAYLVDTAKPTPTPTP
KPSTPTTNNKLTVSSLNGVAQINAKNNGLFTTVYDKTGKPTKEVQKTFAVTKEASLGGNK
FYLVKDYNSPTLIGWVKQGDVIYNNAKSPVNVMQTYTVKPGTKLYSVPWGTYKQEAGAVS
GTGNQTFKATKQQQIDKSIYLFGTVNGKSGWVSKAYLAVPAAPKKAVAQPKTAVKAYAVT
KPQTTQTVSKIAQVKPNNTGIRASVYEKTAKNGAKYADRTFYVTKERAHGNETYVLLNNT
SHNIPLGWFNVKDLNVQNLGKEVKTTQKYTVNKSNNGLSMVPWGTKNQVILTSNNIAQGT
FNATKQVSVGKDVYLYGTINNRTGWVNAKDLTAPTAVKPTTSAAKDYNYTYVIKNGNGYY
YVTPNSDTAKYSLKAFNEQPFAVVKEQVINGQTWYYGKLSNGKLAWIKSTDLAKELIKYN
QTGMTLNQVAQIQAGLQYKPQVQRVPGKWTDANFNDVKHAMDTKRLAQDPALKYQFLRLD
QPQNISIDKINQFLKGKGVLENQGAAFNKAAQMYGINEVYLISHALLETGNGTSQLAKGA
DVVNNKVVTNSNTKYHNVFGIAAYDNDPLREGIKYAKQAGWDTVSKAIVGGAKFIGNSYV
KAGQNTLYKMRWNPAHPGTHQYATDVDWANINAKIIKGYYDKIGEVGKYFDIPQYK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	1105	1239	6.7e-24	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4193	LytD	2.43e-90	1037	1256	36	245	Beta- N-acetylglucosaminidase [Carbohydrate transport and metabolism].
COG5632	CwlA	4.20e-75	243	553	1	302	N-acetylmuramoyl-L-alanine amidase CwlA [Cell wall/membrane/envelope biogenesis].
smart00047	LYZ2	6.11e-43	1092	1251	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
smart00644	Ami_2	7.34e-27	257	385	1	126	Ami_2 domain.
cd06583	PGRP	7.79e-22	258	388	1	126	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXH27454.1	0.0	1	1256	1	1256
BAR11215.1	0.0	1	1256	8	1263
AXG03171.1	0.0	1	1256	1	1256
ASI55112.1	0.0	1	1256	1	1256
AOH59188.1	0.0	1	1256	1	1256

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FXO_A	5.05e-166	1013	1256	1	244	ChainA, Bifunctional autolysin [Staphylococcus aureus subsp. aureus Mu50]
4KNK_A	3.70e-152	198	421	2	225	ChainA, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNK_B Chain B, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_A Chain A, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_B Chain B, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_C Chain C, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_D Chain D, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325]
4EPC_A	5.41e-144	422	757	2	332	Crystalstructure of Autolysin repeat domains from Staphylococcus epidermidis [Staphylococcus epidermidis]
3LAT_A	2.40e-116	206	417	1	212	Crystalstructure of Staphylococcus peptidoglycan hydrolase AmiE [Staphylococcus epidermidis],3LAT_B Crystal structure of Staphylococcus peptidoglycan hydrolase AmiE [Staphylococcus epidermidis]
7KWI_A	6.72e-67	441	588	3	150	ChainA, Bifunctional autolysin [Staphylococcus epidermidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CPQ1	0.0	1	1256	1	1335	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=atl PE=3 SV=1
Q5HQB9	0.0	1	1256	1	1335	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=atl PE=3 SV=1
Q6GAG0	0.0	1	1256	1	1250	Bifunctional autolysin OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=atl PE=3 SV=1
Q6GI31	0.0	1	1256	1	1257	Bifunctional autolysin OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=atl PE=3 SV=1
Q931U5	0.0	1	1256	1	1248	Bifunctional autolysin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=atl PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000265	0.999032	0.000177	0.000182	0.000159	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002337_00898.