CAZyme Information: MGYG000002337_02499

Basic Information

• Species: Staphylococcus aureus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
• CAZyme ID: MGYG000002337_02499
• CAZy Family: GT8
• CAZyme Description: Glycosyltransferase-stabilizing protein Gtf2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452	MGYG000002337_1|CGC26	53034.25	5.4716

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002337	2749621	Isolate	not provided	not provided

• Gene Location: Start: 2662259; End: 2663617 Strand: -

Full Sequence      

MIKLFDYFNDHSRKLYESFKASKLEEDLTIVLNDNGFLPDDVISPYQFFADNHNTENMKP
RFFNQVTVPAFWEIKGNNNSATINDMGRLRGKIFYQSGERPRIVSRVEWFDDQQRVRFVD
YYSKNGIKFAQTVYDLNRKAILKKYMTAEGKEVIYENFVTSDVILDWQGKSYFFPSKLAF
VLFFIKQLEITEHHFVINSLALPFSVLYNLPSNGSDVLVWQEQCDGNVPGNMQLMCKGDM
KRHCNIIIPDKNEYETMLNIADAKVQSRILQGGYLYNYRSRNRYTKEIVILTNSDQLRNI
KVLVETLPDFKFHIAAITEMSDKLMQLDQYANVHLYPSINIDRVNELYQLCDIYLDINEG
NEILNAVEQAFDYELLILGYRQTAHHAKVTLSEHLFEHNDEITMESKDQLIQMLESLKDQ
QQFRDALLAQKAHAHEISREQFEQVFKQALES

Enzyme Prediction     

No EC number prediction in MGYG000002337_02499.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02919	TIGR02919	0.0	1	446	1	438	accessory Sec system glycosyltransferase GtfB. Members of this protein family are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus. [Protein fate, Protein modification and repair]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCY67702.1	0.0	1	452	1	452
QHG76785.1	0.0	1	452	1	452
SQE34866.1	0.0	1	452	1	452
ALR00772.1	0.0	1	452	1	452
QJR43035.1	0.0	1	452	1	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E9U_B	1.76e-99	2	450	2	445	Crystalstructure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_D Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_F Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_H Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii]
5E9T_B	1.81e-99	2	450	2	445	Crystalstructure of GtfA/B complex [Streptococcus gordonii],5E9T_D Crystal structure of GtfA/B complex [Streptococcus gordonii]
5GVW_A	1.63e-09	278	383	269	375	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2UR90	1.82e-110	1	450	1	443	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtfB PE=1 SV=1
Q3S2Y1	2.68e-106	1	417	1	409	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus agalactiae OX=1311 GN=gtfB PE=1 SV=1
Q79T00	1.73e-103	1	450	1	445	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus gordonii OX=1302 GN=gtfB PE=1 SV=1
A1C3M0	2.40e-91	1	411	1	401	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus parasanguinis OX=1318 GN=gtfB PE=1 SV=1
A0A0S4NND9	1.31e-77	1	400	1	394	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtfB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002337_02499.