CAZyme Information: MGYG000002338_00829

Basic Information

• Species: Staphylococcus haemolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus haemolyticus
• CAZyme ID: MGYG000002338_00829
• CAZy Family: CBM50
• CAZyme Description: N-acetylmuramoyl-L-alanine amidase sle1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	MGYG000002338_12|CGC2	28661.53	9.6452

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002338	2548117	Isolate	Russia	Europe

• Gene Location: Start: 49015; End: 49833 Strand: -

Full Sequence      

MKKLAVAASVATGAVAVLSNHNAEASTQHTVKSGESLWSIASKYNTSVDSIKKSNNLSNN
MIFPGQVISIGGSSNNSNNASSNATTSSSTYTVKAGDSLYAIASKNGVTVNALMKANNLS
GYLITPNQKLKIPNGSTTTPSKTNPSTNNNVGGSGGYSSPTFSHQNLYTAGQCTWYVFDR
RAQAGKPISTYWSDAKYWAGNAAADGYTVDHNATVGSIMQTTTGYYGHVAYVERVNADGS
ILISEMNYANGPYNTNTRTIPASVVSSYNFIH

Enzyme Prediction     

No EC number prediction in MGYG000002338_00829.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	4.07e-39	129	272	30	171	Surface antigen [Cell wall/membrane/envelope biogenesis].
PRK08581	PRK08581	8.29e-22	168	271	508	616	amidase domain-containing protein.
PRK06347	PRK06347	3.56e-18	22	169	326	483	1,4-beta-N-acetylmuramoylhydrolase.
pfam05257	CHAP	1.84e-17	166	247	3	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
PRK06347	PRK06347	5.39e-16	29	149	408	541	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFR06234.1	5.77e-179	1	272	1	272
QQQ84103.1	5.77e-179	1	272	1	272
AVH46831.1	5.77e-179	1	272	1	272
AYX83607.1	5.77e-179	1	272	1	272
QFU26024.1	2.35e-178	1	272	1	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2K3A_A	2.34e-37	159	272	43	153	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
2LRJ_A	2.09e-36	161	272	3	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
5T1Q_A	6.27e-14	168	271	248	356	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
4UZ2_A	4.66e-08	89	133	3	47	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	2.29e-06	89	133	3	47	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G0D4	7.87e-116	1	272	1	265	Probable autolysin SsaALP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00671 PE=1 SV=1
Q8CMN2	1.46e-77	1	272	1	324	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q5HRU2	1.46e-77	1	272	1	324	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q49UX4	1.17e-74	1	272	1	327	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q2FJH7	8.17e-74	1	272	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain USA300) OX=367830 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000383	0.998739	0.000208	0.000235	0.000223	0.000186

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002338_00829.