CAZyme Information: MGYG000002339_01630

Basic Information

• Species: Lacticaseibacillus saniviri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus saniviri
• CAZyme ID: MGYG000002339_01630
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000002339_38|CGC3	53224.58	4.7609

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002339	2435520	Isolate	not provided	not provided

• Gene Location: Start: 56140; End: 57564 Strand: -

Full Sequence      

MPEWTTKQRYMPYASYSQEYQTQLIQAQRTSQYHLSYHIQPESGLLNDPNGFSFFNGKWQ
LFYQNFPYGAVHGLKSWQHVTSSDLTHWSAPSLALQPHAPYTTNGVYSGSALPIGDRLFL
MYTGNVRGEDGTRKSTQLGAWMAADGTITELDQPLIAEPPAGYTAHFRDPQIVHVDDQYY
AVIGAQRQDLVGEILVYQAPQPEGPWSLIGPLDWQQGDLGYMMECPNIAFVDGKVVILFC
PQGLARSRFNYQNIYPNTYVIADAIDWTSGRLVNPGQLQTVDAGFDSYATQVVNGPDAQA
YAVSWMGLPEIGYPTDAEGWQGCLSLIKRLTIKDNQLYQEPIVQSLLGNHFEPLHDTLKL
QEVLRFDLETDTTGEIRLGNADEALQLNWTADTLTVDRTQAGIAFGETYGTTRTITWSKG
SHQLELYLDHSTFELFVDGGQQVLSGRIFPRQKQAWTVSAPEQVRVTGQRLKTM

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	38	341	8.6e-76	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01322	scrB_fam	8.31e-165	29	450	9	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd18623	GH32_ScrB-like	1.98e-141	44	334	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG1621	SacC	2.84e-139	9	452	4	461	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	5.16e-107	38	341	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	7.40e-94	38	440	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ90809.1	4.55e-181	1	474	11	486
QFR68829.1	6.13e-154	3	465	4	470
QCJ57477.1	3.18e-152	3	454	6	469
BBM14440.1	3.18e-152	3	454	6	469
QII81734.1	5.15e-152	4	454	7	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NU7_A	2.34e-108	3	451	2	464	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	1.73e-59	27	472	42	483	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	2.51e-58	27	472	42	483	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
7VCO_A	1.39e-57	31	454	23	463	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
1UYP_A	2.32e-39	36	438	5	395	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43471	8.37e-140	4	449	3	461	Sucrose-6-phosphate hydrolase OS=Pediococcus pentosaceus OX=1255 GN=scrB PE=3 SV=2
P13522	7.30e-119	9	458	8	464	Sucrose-6-phosphate hydrolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=scrB PE=3 SV=3
Q04937	1.71e-118	3	454	2	455	Sucrose-6-phosphate hydrolase OS=Lactococcus lactis subsp. lactis OX=1360 GN=scrB PE=1 SV=1
Q05936	1.78e-89	1	449	1	463	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	1.21e-79	4	466	7	470	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002339_01630.