CAZyme Information: MGYG000002342_00045

Basic Information

• Species: Acinetobacter variabilis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter variabilis
• CAZyme ID: MGYG000002342_00045
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
278	MGYG000002342_1|CGC1	30220.57	9.6971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002342	3410950	Isolate	United States	North America

• Gene Location: Start: 49684; End: 50520 Strand: +

Full Sequence      

MGSLVMLSCSHLVYAGETIYQLRDKNGSTLLTNKKSRYNHLQVEKKTYYPDSNIHSYSNW
GSSESSVLPSYSKNKNAFDSIIRQAAQTYGVSEGLIKAVMHTESGFNTHARSPVGAQGLM
QLMPATARRFNVSNAYDPHQNIMAGAKNLAWLLKGFNGNTSLALAGYNAGEGNVSKYGGI
PPFRETQDYVRRVTSRFQNLYTHGLSASTTTSNTPSSEGRILASSANYSNDSSSTSHIQA
AKYQRQIIMNADGSYTDAPMGSYATANATAAAKIYLSE

Enzyme Prediction     

No EC number prediction in MGYG000002342_00045.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	95	202	3.1e-31	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	7.38e-49	93	198	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.97e-43	77	195	5	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	1.31e-38	81	193	7	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	5.78e-36	82	189	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	2.63e-34	82	200	1	159	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKW83577.1	7.14e-192	1	278	1	278
BCT88501.1	7.14e-192	1	278	1	278
AUX88929.1	7.14e-192	1	278	1	278
QXR20181.1	8.74e-189	1	278	13	290
QQN89568.1	2.78e-181	6	278	1	273

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.55e-12	79	193	418	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.56e-12	79	193	422	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.57e-12	79	193	432	562	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.57e-12	79	193	428	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	1.58e-12	79	193	438	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	2.37e-39	77	195	59	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.43e-37	61	197	1408	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.43e-37	61	197	1408	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	1.14e-12	82	201	11	123	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q65VT8	4.20e-12	80	198	191	322	Membrane-bound lytic murein transglycosylase C OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.471761	0.482703	0.043940	0.000769	0.000372	0.000449

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002342_00045.