CAZyme Information: MGYG000002342_00409

Basic Information

• Species: Acinetobacter variabilis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter variabilis
• CAZyme ID: MGYG000002342_00409
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
194		21382.46	10.0214

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002342	3410950	Isolate	United States	North America

• Gene Location: Start: 67224; End: 67808 Strand: +

Full Sequence      

MNTTQIKKLQMAVGVHDDGIIGRDTLTAVFKKLGASQARAEELGLAANIHMRTYGILDNS
LRLIHFLAQLAHESGNFRYMEEIASGAAYEGRKDLGNTQVGDGKRFKGRGPIQLTGRTNY
RKYGQQLGIDFENNPEIVAIPSIGLMVACKFWSDNGLNALADKDDVLTITRRINGGTNGL
ADRKAHLTKLRLWV

Enzyme Prediction     

No EC number prediction in MGYG000002342_00409.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	60	157	9.7e-33	0.44155844155844154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	2.30e-36	46	192	26	202	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	5.42e-14	66	176	52	189	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	5.36e-12	66	152	56	154	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGR73965.1	4.39e-133	1	194	1	194
AUC07410.1	2.09e-131	1	194	1	194
QSE47457.1	2.44e-130	1	194	1	194
QIC67480.1	3.06e-129	1	194	1	194
ASN70348.1	5.51e-127	1	194	1	194

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	2.66e-14	66	191	57	219	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
5H7T_A	2.94e-11	59	155	59	155	ChainA, Class IV chitinase [Cryptomeria japonica]
4IJ4_A	4.89e-10	53	176	40	166	CrystalStructure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
3WH1_A	4.95e-10	53	176	41	167	CrystalStructure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
4DWX_A	5.84e-08	66	152	61	159	CrystalStructure of a Family GH-19 Chitinase from rye seeds [Secale cereale],4DWX_B Crystal Structure of a Family GH-19 Chitinase from rye seeds [Secale cereale],4DYG_A Crystal Structure of a Family GH-19 Chitinase from rye seeds in complex with (GlcNAc)4 [Secale cereale],4DYG_B Crystal Structure of a Family GH-19 Chitinase from rye seeds in complex with (GlcNAc)4 [Secale cereale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O64203	4.39e-19	59	184	214	351	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1
P44187	7.31e-13	59	183	36	187	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O22842	3.74e-12	67	176	142	247	Endochitinase At2g43610 OS=Arabidopsis thaliana OX=3702 GN=At2g43610 PE=1 SV=1
O22841	1.85e-11	67	176	144	249	Endochitinase At2g43620 OS=Arabidopsis thaliana OX=3702 GN=At2g43620 PE=3 SV=1
Q5NTA4	3.11e-10	59	155	128	224	Endochitinase 4 OS=Cryptomeria japonica OX=3369 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002342_00409.