CAZyme Information: MGYG000002342_02471

Basic Information

• Species: Acinetobacter variabilis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter variabilis
• CAZyme ID: MGYG000002342_02471
• CAZy Family: AA3
• CAZyme Description: Oxygen-dependent choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	MGYG000002342_89|CGC1	61592.64	6.4045

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002342	3410950	Isolate	United States	North America

• Gene Location: Start: 6060; End: 7715 Strand: +

Full Sequence      

MNYDYIIIGAGSAGNVLAARLTEDPDTKVLLLEAGGPDYRLDFRTQMPAALAYPLQGRRY
NWAYLTDPEPHMNNRRMECGRGKGLGGSSLINGMCYIRGNAMDLEQWASFKGLEHWNYAQ
CLPYYKKAETRDIGGNDYHGDSGPVSVATPKNGNNELFHAMVEAGVQAGYPRTDDLNGYQ
QEGFGPMDRTVTPQGRRSSTARGYLDMAKGRDNLTIITHAMTNRILFNRNQAIGVEYFEG
QNTLQPIQVFADREVLLCAGAIASPQILQRSGIGPAELLKSLDIPVVQDLPGVGENLQDH
LEMYLQYKCKKPVSLYPALKWYNQPMIGAEWLFLGKGIGASNQFEAGGFIRSSDEFEWPN
IQYHFLPVAINYNGTNAIHEHGFQAHVGSMRSPSRGRVRLKSKDPFEHPSILFNYMSTEQ
DWREFRDAIRITREIMHQPALDPYRGEEISPGKNLQTDAEIDEFVRNHAETAYHPSCSCK
MGEDDMAVVDGYGRVHEMQGLRVIDASIMPLIITGNLNATTIMMAEKLADHIRGKQALPA
STAPFYRAPRA

Enzyme Prediction     

No EC number prediction in MGYG000002342_02471.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	2	533	5.2e-164	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2303	BetA	0.0	1	538	6	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
TIGR01810	betA	0.0	4	538	1	532	choline dehydrogenase. Choline dehydrogenase catalyzes the conversion of exogenously supplied choline into the intermediate glycine betaine aldehyde, as part of a two-step oxidative reaction leading to the formation of osmoprotectant betaine. This enzymatic system can be found in both gram-positive and gram-negative bacteria. As in Escherichia coli, Staphylococcus xylosus, and Sinorhizobium meliloti, this enzyme is found associated in a transciptionally co-induced gene cluster with betaine aldehyde dehydrogenase, the second catalytic enzyme in this reaction. Other gram-positive organisms have been shown to employ a different enzymatic system, utlizing a soluable choline oxidase or type III alcohol dehydrogenase instead of choline dehydrogenase. This enzyme is a member of the GMC oxidoreductase family (pfam00732 and pfam05199), sharing a common evoluntionary origin and enzymatic reaction with alcohol dehydrogenase. Outgrouping from this model, Caulobacter crescentus shares sequence homology with choline dehydrogenase, yet other genes participating in this enzymatic reaction have not currently been identified. [Cellular processes, Adaptations to atypical conditions]
PRK02106	PRK02106	0.0	1	551	4	550	choline dehydrogenase; Validated
TIGR03970	Rv0697	7.92e-94	4	533	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
pfam00732	GMC_oxred_N	3.26e-62	73	302	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANI26486.1	2.57e-186	2	549	70	618
CAB3230510.1	6.34e-186	3	546	25	569
AWP09430.1	6.14e-185	2	547	19	565
CAG5089487.1	3.24e-160	3	547	17	573
CAG5086058.1	2.16e-159	1	548	13	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HA6_A	2.00e-82	2	529	1	501	Crystalstructure of pyridoxine 4-oxidase - pyridoxamine complex [Mesorhizobium loti]
3T37_A	3.20e-82	2	529	17	517	Crystalstructure of pyridoxine 4-oxidase from Mesorbium loti [Mesorhizobium loti]
6YRU_AAA	6.71e-80	3	543	8	571	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	6.71e-80	3	543	8	571	ChainA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	9.40e-80	3	543	8	571	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6DKY4	0.0	1	546	1	543	Oxygen-dependent choline dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=betA PE=3 SV=1
Q1CFR7	0.0	1	546	1	545	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1
Q1C932	0.0	1	546	1	545	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=betA PE=3 SV=1
Q02DZ0	0.0	3	546	5	547	Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=betA PE=3 SV=1
Q4ZM63	0.0	3	546	7	549	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002342_02471.