CAZyme Information: MGYG000002342_02819

Basic Information

• Species: Acinetobacter variabilis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter variabilis
• CAZyme ID: MGYG000002342_02819
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445	MGYG000002342_126|CGC1	50859.55	8.7316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002342	3410950	Isolate	United States	North America

• Gene Location: Start: 5443; End: 6780 Strand: -

Full Sequence      

MIIDESQREASRIYFSVQLKFVIALMGACFWTVFSIWIVQDWMHDLSTYVGYFWAIFLIY
GIAIIPGFMNSFAALSLMMDRRPKRQPLAVYPGITMLVAAYNEAASIEDTLVSINQQKYP
GKLQVIVINDGSQDETAEIVRKAESRFPWLTLLDLKQNAGKAHALNEGLKLAEHDLVITV
DADSYLHRIALINIVERYVADPPNTRAVAGKILVRNSRTNLLTKTQEWDYFLGISATKRL
QSLYQGTLVAQGAFSIYDRNALIEVGGWPECVGEDIVLTWALLNAGYRIGHCEDACLFTN
APTTLKVFVKQRQRWARGMIEAFIKHPSILIKPRLSTFFIYWNLFFPWLDIAFTFGFIPG
IILACFGHYWIVGIMTLVLLPMAFLLGFLNYSIERRMFNDLELKVRKNFSGFLLYVLAYS
FLLQPASILGYMDEVLRTRKTWGTK

Enzyme Prediction     

No EC number prediction in MGYG000002342_02819.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	97	265	3.5e-29	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	2.39e-54	97	275	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	2.31e-51	46	432	4	406	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	3.14e-51	81	424	41	356	N-glycosyltransferase; Provisional
cd06439	CESA_like_1	2.43e-41	48	322	1	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
PRK14583	hmsR	2.27e-35	92	440	75	427	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APX64000.1	3.55e-283	1	445	1	445
AUX91276.1	5.89e-254	96	445	1	350
AUX87999.1	5.07e-252	53	445	2	394
QXX87880.1	2.71e-243	96	445	1	350
QKQ71349.1	2.02e-238	96	445	1	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	7.85e-17	92	325	42	270	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	7.92e-17	92	325	43	271	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5EJ1_A	4.82e-11	68	327	104	384	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	5.04e-11	68	327	116	396	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	5.04e-11	68	327	117	397	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9RQP9	1.02e-40	93	340	48	292	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q5HCN1	1.02e-40	93	340	48	292	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6GDD8	1.02e-40	93	340	48	292	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	1.02e-40	93	340	48	292	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q99QX3	1.02e-40	93	340	48	292	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	38
53	75
339	361
366	388
409	431