CAZyme Information: MGYG000002343_01977

Basic Information

• Species: Acinetobacter courvalinii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter courvalinii
• CAZyme ID: MGYG000002343_01977
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
182		20567.75	8.995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002343	4074146	Isolate	United States	North America

• Gene Location: Start: 153622; End: 154170 Strand: +

Full Sequence      

MTITQDGFDILRKNFGKLAQSQVDGINFLVSVLAEDTAIITTQAAYILATAWHETAKTMQ
PVIEYGSEKYLKSKQYYPYIGYGYVQLTWLSNYKRLGDYLKIDLVKNPKLALQADIAARV
MIVGMKKGMFTGKRLSDYINQHKKNYVGARYIVNGTDKAELVASYAEIFEKALEASEEVV
CH

Enzyme Prediction     

No EC number prediction in MGYG000002343_01977.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	37	120	6.2e-16	0.4155844155844156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	5.33e-05	77	120	114	157	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	0.003	74	122	101	149	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	0.004	73	110	104	138	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHH95004.1	7.49e-108	1	177	1	177
AFU62320.1	4.38e-73	1	173	1	173
ADF97551.1	2.01e-57	1	173	1	185
QVP35881.1	1.21e-55	1	173	1	182
ARQ94871.1	1.21e-55	1	173	1	182

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002343_01977.