CAZyme Information: MGYG000002344_02781

Basic Information

• Species: Acinetobacter baumannii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter baumannii
• CAZyme ID: MGYG000002344_02781
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000002344_1|CGC21	41252.74	9.8819

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002344	3953404	Isolate	United States	North America

• Gene Location: Start: 2922312; End: 2923424 Strand: -

Full Sequence      

MHSNSSSGSRLGLSSLFSSLPLKVLALSTMFFPFHSINAGKTLQYNTVVNTNTLTVVAVE
SPTTVFKEDQFLHGFGYDLARNYAQSLNVKLDFKIVTDNATALKWVQQGKANLAMTTASL
SSIENKGLMSFSASCGDIVNLQKNGLNPNLSWVFKQADDPLTQTASGFVCQSKQNGLTQQ
LASFYNRNVVKPEAWSTIQRDLSARIPIYKASFKQSAAQYDLDWHLLAAIGYQESYLKPE
SVSPTGVRGLMMLTNSTARAMGVSNRNDPAQSIQGGAKYYDLMLSEYDDIPFPDRNWYAL
VAYNMGPGAVNQIQKRLQAQGKDPNQWVNLYNYLQSNKTRNGRYKQAVQYVTRIRAYLEH
IKTAQTRINI

Enzyme Prediction     

No EC number prediction in MGYG000002344_02781.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	222	366	1.3e-23	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	3.55e-65	213	363	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	5.86e-61	24	357	15	446	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	1.13e-50	149	361	208	431	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd00254	LT-like	1.39e-20	226	359	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	3.66e-20	213	323	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOX98022.1	7.02e-268	1	370	1	370
APO60191.1	7.02e-268	1	370	1	370
QER34952.1	7.02e-268	1	370	1	370
AXX41219.1	7.02e-268	1	370	1	370
ATU51764.1	7.02e-268	1	370	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	2.30e-45	150	359	197	419	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	2.65e-45	150	359	204	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	2.65e-45	150	359	204	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	5.01e-45	150	359	190	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	5.01e-45	150	359	190	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02RN8	7.34e-46	150	359	229	450	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=mltF PE=3 SV=2
A4VP14	1.88e-45	103	359	187	449	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=mltF PE=3 SV=2
A6V102	2.83e-44	150	359	229	451	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=mltF PE=3 SV=1
Q9HXN1	3.94e-44	150	359	229	451	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mltF PE=1 SV=2
Q4KHS7	1.91e-41	151	359	228	449	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.257057	0.740934	0.001067	0.000420	0.000243	0.000257

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002344_02781.