CAZyme Information: MGYG000002344_02987

Basic Information

• Species: Acinetobacter baumannii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter baumannii
• CAZyme ID: MGYG000002344_02987
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
169		18759.6	10.0477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002344	3953404	Isolate	United States	North America

• Gene Location: Start: 3109489; End: 3109998 Strand: +

Full Sequence      

MSNKTKYAVGLLAASAAFFMGVKVDEGYTSKPVIPVKGDRPTQGHGSTFKLDGSPVKMTD
PPITRATADKWLRNDVAKREVAFKDSLKGVKLSQTEYDLYLDFTYQYGIGAWSGSSMLKN
LKIGNYKAACESLLKWKYVAKRDCSIRSNGCYGVWTRQLERHAKCIGAQ

Enzyme Prediction     

No EC number prediction in MGYG000002344_02987.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	16	145	8.5e-27	0.9124087591240876

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16901	lyz_P1	4.10e-52	13	166	1	140	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd00737	lyz_endolysin_autolysin	1.38e-20	22	138	5	115	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	5.57e-13	22	165	15	147	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16900	endolysin_R21-like	3.89e-11	10	142	2	125	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00959	Phage_lysozyme	8.33e-09	41	164	2	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKY24202.1	1.30e-115	1	169	1	169
ABO12443.2	1.30e-115	1	169	1	169
QDQ53670.1	1.30e-115	1	169	1	169
QDQ66626.1	1.30e-115	1	169	1	169
APX51095.1	1.30e-115	1	169	1	169

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7M5I_A	5.43e-12	18	150	19	141	ChainA, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]
2ANV_A	4.31e-11	22	141	12	128	ChainA, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]
6ET6_A	1.84e-09	42	136	79	171	ChainA, Lysozyme [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P09963	2.36e-10	22	141	12	128	Endolysin OS=Salmonella phage P22 OX=10754 GN=19 PE=1 SV=1
Q9T1T5	1.27e-08	37	136	25	117	Endolysin OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=13 PE=3 SV=1
Q37896	3.02e-07	63	136	48	120	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
P68920	5.34e-07	50	167	57	174	SAR-endolysin OS=Escherichia phage 933W OX=10730 GN=R PE=3 SV=1
P68921	5.34e-07	50	167	57	174	SAR-endolysin OS=Enterobacteria phage VT2-Sa OX=97081 GN=R PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.918153	0.072625	0.008581	0.000204	0.000122	0.000303

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002344_02987.