CAZyme Information: MGYG000002344_03720

Basic Information

• Species: Acinetobacter baumannii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter baumannii
• CAZyme ID: MGYG000002344_03720
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208		23146.7	9.8754

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002344	3953404	Isolate	United States	North America

• Gene Location: Start: 42903; End: 43529 Strand: -

Full Sequence      

MIEAMQRAKTYKIHNSIIKLSAIVFGACVTSTTYAVCWDEAASMYGTDPILLKAIGWKES
RGHVGAVGSLLKDGNRALGLMQINTIHLPALRKQGITRNDLFDPCTSQKIASWVLADCLK
KFGEVWRAVGCYYGGPASKAYTAMNQYSADVRRYFEGYKRKAGLPAVYTPLQPQSIKAQS
VNYNEDIPNYSSVNQTIKKTSNFQIIRF

Enzyme Prediction     

No EC number prediction in MGYG000002344_03720.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	38	161	2e-18	0.9037037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	3.72e-39	45	156	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	2.46e-28	32	166	16	147	type III secretion system invasion protein IagB.
pfam01464	SLT	3.71e-18	38	163	1	111	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	9.21e-17	37	164	22	151	lytic transglycosylase; Provisional
cd16892	LT_VirB1-like	1.88e-10	70	135	53	124	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVE56862.1	1.12e-151	1	208	1	208
ANR95853.1	1.12e-151	1	208	1	208
QEE59126.1	1.12e-151	1	208	1	208
QAS99789.1	1.12e-151	1	208	1	208
QJG90106.1	1.12e-151	1	208	1	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	4.61e-13	37	120	3	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	7.80e-22	31	166	15	147	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	7.80e-22	31	166	15	147	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	1.67e-20	31	160	15	141	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q00739	6.88e-17	37	164	22	151	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P47737	1.35e-16	37	164	22	151	X polypeptide OS=Escherichia coli (strain K12) OX=83333 GN=yubQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002411	0.624517	0.371714	0.000696	0.000360	0.000288

TMHMM  Annotations     

start	end
20	42