CAZyme Information: MGYG000002345_00046

Basic Information

• Species: Acinetobacter nosocomialis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter nosocomialis
• CAZyme ID: MGYG000002345_00046
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000002345_1|CGC1	41435.98	9.8567

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002345	4020363	Isolate	United States	North America

• Gene Location: Start: 52184; End: 53296 Strand: -

Full Sequence      

MHSNSSSGSRLSLNSLFSSLPLKVLALSTMFFPFHSINAGKTLQYNTVVNTNTLTVVAVE
SPTTVFKEDQFLHGFGYDLARNYAQSLNVKLDFKIVADNATALKWVQQGKANLAMTTASL
SSIENKGLMSFSASCGDIVNLQKNGLNPDLSWVFKQADDPLTQTASGFVCQSKQNGLTQQ
LASFYNRNVVKPESWSTIQRDISTRLPIYKASFKQSAAKYDLDWHLLAAMSYQESYLKPE
SVSPTGVRGLMMLTNSTARAMGVSNRSDPAQSIQGGAKYYDLMLSEYGDIPYPDRNWYAL
VAYNMGPGAVNQIQKRLQTQGKDPNQWVNLYDYLQRNQMRNGRYKQAVQYVTRIRAYLEH
IKTAQTRINI

Enzyme Prediction     

No EC number prediction in MGYG000002345_00046.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	222	366	9.3e-23	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.26e-63	213	363	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	1.49e-62	24	357	15	446	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	1.99e-51	149	361	208	431	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	2.09e-20	213	323	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.26e-19	226	359	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA45028.1	8.19e-267	1	370	1	370
AJB47357.1	8.19e-267	1	370	1	370
QCP64831.1	9.56e-266	1	370	1	370
QEH28718.1	1.93e-265	1	370	1	370
ARG16099.1	1.93e-265	1	370	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.27e-42	150	336	197	387	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	1.45e-42	150	336	204	394	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.45e-42	150	336	204	394	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	2.70e-42	150	336	190	380	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	2.70e-42	150	336	190	380	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02RN8	3.88e-43	150	336	229	418	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=mltF PE=3 SV=2
A4VP14	9.90e-42	103	336	187	417	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=mltF PE=3 SV=2
A6V102	1.46e-41	150	336	229	419	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=mltF PE=3 SV=1
Q9HXN1	2.03e-41	150	336	229	419	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mltF PE=1 SV=2
A1U3J1	1.74e-40	149	334	223	412	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.188557	0.809028	0.001393	0.000451	0.000268	0.000281

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002345_00046.