CAZyme Information: MGYG000002345_01167

Basic Information

• Species: Acinetobacter nosocomialis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter nosocomialis
• CAZyme ID: MGYG000002345_01167
• CAZy Family: AA3
• CAZyme Description: Oxygen-dependent choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	MGYG000002345_4|CGC3	61283.28	7.0255

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002345	4020363	Isolate	United States	North America

• Gene Location: Start: 110973; End: 112631 Strand: +

Full Sequence      

MNIKEYDYIIIGAGSAGNVLAARLTEDKDTTVLLLEAGGPDYRLDFRTQMPAALAYPLQG
RRYNWAYLTDPEPHMNNRRMECGRGKGLGGSSLINGMCYIRGNAMDLEQWATHKGLENWT
YADCLPYYKKAETRDIGGNDYHGDSGPVSVATPKNGNNVLFHAMVEAGVQAGYPRTDDLN
GYQQEGFGPMDRTVTPKGRRSSTARGYLDMAKGRPNLTILTHATTNKILFNQKQAIGVEY
IIGADQNNLQRALVKREVLLCAGAIASPQILQRSGVGQSTFLKSMDIDVVHDLPGVGENL
QDHLEMYLQYKCKQPVSLYPALKWYNQPAIGAEWLFNGTGIGASNQFEAGGFIRSSDEFK
WPNIQYHFLPVAINYNGSNAVKEHGFQAHVGSMRSPSRGRIKLKSKDPFAHPSILFNYMS
TEQDWREFRDAIRITREIMQQSALDPYRGDEISPGKHLQTDAELDDFVRNHAETAYHPSC
SCKMGEDEMAVVDGQGRVHGMNGLRVVDASIMPLIITGNLNATTIMIAEKIADQIRGREA
LPRSTAPFYVAS

Enzyme Prediction     

No EC number prediction in MGYG000002345_01167.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	536	1.5e-164	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2303	BetA	0.0	4	541	6	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
PRK02106	PRK02106	0.0	1	551	1	547	choline dehydrogenase; Validated
TIGR01810	betA	0.0	7	541	1	532	choline dehydrogenase. Choline dehydrogenase catalyzes the conversion of exogenously supplied choline into the intermediate glycine betaine aldehyde, as part of a two-step oxidative reaction leading to the formation of osmoprotectant betaine. This enzymatic system can be found in both gram-positive and gram-negative bacteria. As in Escherichia coli, Staphylococcus xylosus, and Sinorhizobium meliloti, this enzyme is found associated in a transciptionally co-induced gene cluster with betaine aldehyde dehydrogenase, the second catalytic enzyme in this reaction. Other gram-positive organisms have been shown to employ a different enzymatic system, utlizing a soluable choline oxidase or type III alcohol dehydrogenase instead of choline dehydrogenase. This enzyme is a member of the GMC oxidoreductase family (pfam00732 and pfam05199), sharing a common evoluntionary origin and enzymatic reaction with alcohol dehydrogenase. Outgrouping from this model, Caulobacter crescentus shares sequence homology with choline dehydrogenase, yet other genes participating in this enzymatic reaction have not currently been identified. [Cellular processes, Adaptations to atypical conditions]
pfam00732	GMC_oxred_N	1.11e-62	76	305	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
pfam05199	GMC_oxred_C	4.32e-46	397	531	3	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB3230510.1	1.07e-184	5	550	24	570
ANI26486.1	2.26e-182	5	549	70	615
AWP09430.1	4.75e-182	5	549	19	564
CAG5086058.1	7.19e-158	5	551	14	579
CAG5089487.1	3.47e-157	4	549	15	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZH7_A	3.12e-82	4	546	6	571	ChainA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	3.12e-82	4	546	6	571	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	4.37e-82	4	546	6	571	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	4.58e-82	4	546	22	587	Structureof Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	6.13e-82	4	546	6	571	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1C932	0.0	5	551	2	547	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=betA PE=3 SV=1
Q3K5H3	0.0	4	551	3	549	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=betA PE=3 SV=1
Q1IG70	0.0	4	551	3	549	Oxygen-dependent choline dehydrogenase OS=Pseudomonas entomophila (strain L48) OX=384676 GN=betA PE=3 SV=1
Q1CFR7	0.0	5	551	2	547	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1
Q4K4K7	0.0	4	551	3	549	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000008	0.000024	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002345_01167.