CAZyme Information: MGYG000002345_03211

Basic Information

• Species: Acinetobacter nosocomialis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter nosocomialis
• CAZyme ID: MGYG000002345_03211
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1074	MGYG000002345_23|CGC1	115793.34	9.8508

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002345	4020363	Isolate	United States	North America

• Gene Location: Start: 42191; End: 45415 Strand: -

Full Sequence      

MYKPTTFVWQPSAASLFKITVLSSALAALGITTGCSSTPQSAKTSKTKQVSGAGYLDASS
LDSLEDLLSATDMRAVEGDRLLILKHGDVWKRMAVGFKMDLNHWDPRIEAQRSWFISRQP
YLDRLSARASRYLYHTVKEAERRGLPTELALLPVIESSYDPAATSSAAAAGLWQFIPSTG
RIYGLQQTGMYDGRRDVVESTRAAYEFLGSLYNQFGSWELALAAYNAGPGRIQQAINRNQ
AAGLPTDYWSLKLPQETMNYVPRFLAVAQIIKNPRAYGVSLPPIANRPHFREVTLSAPLS
LNEIASVTGLSRAELYALNPGYRGETVDPASPMRILIPADVSPSVDNKLKAMKAGGSSSG
WWANVTSPSKPTTTTSTSVTVKTTPATQVQPVRPTTPTKTTGSSVTVKTSTPRGSDALAA
FAASADVPSAPRIPVAVTPATNVKPVRTEPPISAVEREKILAAVRAEGEKETVEQALQPQ
ATQAEKDQVVAELKAIAPQGTEIVDPYDGKIKLTAIQTSLSVAEQQGKELSKGFAYPKTL
AEDASVANSEDGQRNKDKPYIKTDTDVVVVQPKGKRSTYTVQPGDTLAIIAMKNGVNWRD
VAKWNQIDPEKTLFVGTSLYLYDAKPQEVESTAKAAAKPDVYVVQANDSLTGVANQFNLS
VKQLAEYNDLSVSDGLFVGQKLHLKEPKGNRTSAKAEQPKAVQASTRRIATKSYTVKRGE
YLKLIADRYALSNQELAELTPGLSAGSNLMVGQKINVPAKEVTVDEVDDNKASGKYEKLA
AGPSYKTESYKVQRGDTLSSIATKSKISLAELAELNNLKANSHVQLGQNLKVPAGVSVPD
HYVVQSGDSLHAIAAKYNLQTSYLADLNGLSRTAGVRAGQRLKLTGEVETPSKATTKNVK
EETPETYTVKSGDSLGNIANRYHLQLDYLASLNGLSRNSNVRVGQRLKLTGDVPPVETAK
VDTAKSAAKPVAPGKNTEKYTVKAGESLHTIASRAGISVRELAEMNALKANANLQRGQNI
VIPKTVVEYKVKRGDTLIGLASKYGLETTLLAELNNLTPSTQLRIGDIIKVPNL

Enzyme Prediction     

No EC number prediction in MGYG000002345_03211.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	138	276	5.1e-24	0.8962962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10783	mltD	3.54e-76	18	338	4	311	membrane-bound lytic murein transglycosylase D; Provisional
cd16894	MltD-like	2.38e-56	141	269	2	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK06347	PRK06347	1.51e-23	685	949	306	591	1,4-beta-N-acetylmuramoylhydrolase.
pfam01464	SLT	1.03e-21	138	243	3	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK06347	PRK06347	2.56e-21	782	1061	325	582	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH30302.1	0.0	1	1027	1	1027
QCA01478.1	0.0	1	1027	1	1027
AJB48960.1	0.0	1	1026	1	1026
QBF78941.1	0.0	1	1026	1	1026
AZC02916.1	0.0	1	1026	1	1026

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	1.41e-09	790	959	44	226	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
6FBT_A	9.40e-07	90	270	400	591	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	9.65e-07	90	270	429	620	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	2.14e-06	90	270	400	591	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	2.15e-06	90	270	401	592	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	3.77e-61	79	338	49	308	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	3.77e-61	79	338	49	308	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	5.60e-28	126	288	19	178	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
P37710	1.39e-24	574	949	358	736	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q49UX4	3.79e-21	790	951	29	195	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000284	0.006801	0.992896	0.000037	0.000009	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002345_03211.