CAZyme Information: MGYG000002346_01547

Basic Information

• Species: Acinetobacter pittii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter pittii
• CAZyme ID: MGYG000002346_01547
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
181		20180.06	9.2061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002346	3962855	Isolate	United States	North America

• Gene Location: Start: 28767; End: 29312 Strand: +

Full Sequence      

MNIEKYLDELIKREGGYVNNPADRGGATKYGITEAVARANGFKGNMRDLPLDVAKAIYRK
NYWTAPRFDQVNAISSAVAEELLDTGVNCGTGFAKPLLQRALNLLNNQGKAGFPDLEVDG
VYGSETLGALKTYLSKRGKEGEKVLVRVLNIMQGQRYIEICERNPKQEQFFYGWIANRVV
I

Enzyme Prediction     

No EC number prediction in MGYG000002346_01547.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH108	7	90	5.5e-29	0.9767441860465116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13926	N-acetylmuramidase_GH108	1.54e-41	1	90	1	91	N-acetylmuramidase domain of the glycosyl hydrolase 108 family. This domain acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a peptidoglycan binding domain.
COG3926	ZliS	3.19e-41	2	179	4	172	Lysozyme family protein [General function prediction only].
pfam05838	Glyco_hydro_108	9.49e-36	7	90	1	86	Glycosyl hydrolase 108. This family acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a C-terminal pfam09374 domain.
pfam09374	PG_binding_3	8.82e-13	98	179	6	76	Predicted Peptidoglycan domain. This family contains a potential peptidoglycan binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZB98940.1	9.05e-131	1	181	1	181
QOW98143.1	9.05e-131	1	181	1	181
AUT34995.1	9.05e-131	1	181	1	181
QEA26086.1	9.05e-131	1	181	1	181
QEI28776.1	9.05e-131	1	181	1	181

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6V3Z_A	8.68e-60	4	181	23	199	ChainA, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis],6V3Z_B Chain B, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis]
6V40_A	7.61e-53	10	179	27	195	ChainA, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_B Chain B, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_C Chain C, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_D Chain D, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi]
7DNP_A	7.50e-11	5	137	8	129	ChainA, Secretion activator protein, hypothetical [Brucella abortus bv. 1 str. 9-941]
2NR7_A	3.86e-07	2	132	6	131	StructuralGenomics, the crystal structure of putative secretion activator protein from Porphyromonas gingivalis W83 [Porphyromonas gingivalis W83]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002346_01547.