CAZyme Information: MGYG000002347_00635

Basic Information

• Species: Streptococcus anginosus_C
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus anginosus_C
• CAZyme ID: MGYG000002347_00635
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235	MGYG000002347_1|CGC5	26130.21	8.2238

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002347	1888139	Isolate	not provided	not provided

• Gene Location: Start: 636630; End: 637337 Strand: -

Full Sequence      

MRKKKLKKGILTVLALVTAALLVSAVLSKQVHPASANDETYQRPLTQTEVFISQIGETAR
QLGQENDLYASVMIAQAILESNSGRSALSAAPHHNLFGIKGQYAGQSATMPTLEDDGQGN
SYNVNAEFRSYPSYVESLQDYVAILKHSRYTYAWKSNTTSYMNATAALTGVYATDTSYNV
KLNNLIQQYNLTQYDVPNVQATNVATTNKVYNPYRQQYTTQEVLDLDVAWANRHQ

Enzyme Prediction     

No EC number prediction in MGYG000002347_00635.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	56	191	4e-28	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK08581	PRK08581	2.24e-63	47	199	319	476	amidase domain-containing protein.
COG1705	FlgJ	5.31e-61	7	196	2	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	1.17e-57	33	212	133	320	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	1.46e-28	48	195	8	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	2.05e-25	51	195	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIK77941.1	3.97e-163	1	235	1	235
ALL02878.1	3.97e-163	1	235	1	235
ANW85012.1	3.97e-163	1	235	1	235
VEE12245.1	3.13e-160	1	235	1	235
QOG24603.1	3.13e-160	1	235	1	235

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T1Q_A	2.29e-41	48	195	60	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3FI7_A	2.04e-39	34	195	22	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN4_A	7.15e-14	51	204	6	163	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	7.35e-14	51	188	6	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	1.16e-40	34	197	166	335	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q2G222	7.31e-40	48	195	320	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P39046	2.29e-37	48	197	62	216	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
A2RHZ5	4.52e-35	42	195	56	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	1.22e-34	42	195	56	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001288	0.941039	0.056894	0.000279	0.000244	0.000220

TMHMM  Annotations     

start	end
9	28