CAZyme Information: MGYG000002348_00906

Basic Information

• Species: Lactobacillus crispatus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus crispatus
• CAZyme ID: MGYG000002348_00906
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215	MGYG000002348_15|CGC1	24966.72	10.1765

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002348	1829425	Isolate	Ireland	Europe

• Gene Location: Start: 15654; End: 16301 Strand: +

Full Sequence      

MARKRKSRVPKSVKTVVRVFVILFILMVAFVGFRYYRRYAIQSEQIRQAQLQKEQEAAKL
LKQKKDFIKKIGPIAREVDKSYDLLPSITIAQACLESNYGQSDLSQKYNNLFGVKGSNPN
TSAVMTTKEYVKNKWVTVKARFQIYDSYEASIRAHARLFQNGTTWNYDQYKHVLASKDYK
TQAKALVTDGYATDPDYADKLINLIEQFDLEKYDK

Enzyme Prediction     

No EC number prediction in MGYG000002348_00906.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	72	210	8e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	9.18e-65	18	215	4	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	8.41e-37	62	215	318	473	amidase domain-containing protein.
smart00047	LYZ2	7.53e-35	65	214	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	5.72e-28	66	214	162	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK06347	PRK06347	1.29e-27	65	214	151	303	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGY94426.1	2.32e-127	1	215	1	215
QWW28640.1	2.32e-127	1	215	1	215
QLL74573.1	2.32e-127	1	215	1	215
QPP18046.1	2.32e-127	1	215	1	215
QHQ68554.1	2.32e-127	1	215	1	215

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	7.82e-27	67	214	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	9.23e-19	62	214	58	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.38e-13	65	207	4	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.84e-13	65	207	4	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.95e-13	67	205	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.35e-39	67	215	51	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P39046	1.47e-23	67	214	65	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q9CIT4	8.80e-22	67	214	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	2.25e-21	67	214	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	7.95e-21	67	214	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999403	0.000085	0.000022	0.000000	0.000000	0.000522

TMHMM  Annotations     

start	end
15	37