CAZyme Information: MGYG000002349_01067

Basic Information

• Species: Streptococcus agalactiae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus agalactiae
• CAZyme ID: MGYG000002349_01067
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	MGYG000002349_38|CGC1	24570.51	10.3555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002349	2041264	Isolate	United States	North America

• Gene Location: Start: 26938; End: 27642 Strand: +

Full Sequence      

MNKRRKLSKLNVKKHHLAYGAITLVALFSCILAVMVIFKSSQVTTESLSKADKVRVAKKS
KMTKATSKSKVEDVKQAPKPSQASNEAPKSSSQSTEANSQQQVTASEEAAVEQAVVTENT
PATSQAQQAYAVTETTYRPAQHQTSGQVLSNGNTAGAIGSAAAAQMAAATGVPQSTWEHI
IARESNGNPNVANASGASGLFQTMPGWGSTATVQDQVNSAIKAYRAQGLSAWGY

Enzyme Prediction     

No EC number prediction in MGYG000002349_01067.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13925	RPF	2.90e-09	175	233	1	69	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
cd00254	LT-like	7.19e-05	180	218	7	45	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	5.88e-04	171	211	9	46	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13402	LT_TF-like	8.36e-04	176	206	3	41	lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK01770	PRK01770	0.001	46	145	61	166	Sec-independent protein translocase subunit TatB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQY27334.1	7.50e-147	1	234	1	234
AIF89580.1	7.50e-147	1	234	1	234
AXO11414.1	7.50e-147	1	234	1	234
AKU04566.1	7.50e-147	1	234	1	234
AYZ23418.1	7.50e-147	1	234	1	234

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CMZ9	1.42e-36	149	233	150	234	Probable transglycosylase IsaA OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=isaA PE=3 SV=1
Q5HL49	1.42e-36	149	233	150	234	Probable transglycosylase IsaA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=isaA PE=3 SV=1
Q6GDN1	1.39e-32	149	234	148	233	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=isaA PE=3 SV=1
Q2YWD9	5.44e-32	149	234	148	233	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=isaA PE=3 SV=1
Q6G6A5	2.13e-31	149	234	148	233	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=isaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000013	0.000010	0.000001	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
16	38