CAZyme Information: MGYG000002350_03919

Basic Information

• Species: Serratia marcescens_I
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Serratia; Serratia marcescens_I
• CAZyme ID: MGYG000002350_03919
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221	MGYG000002350_140|CGC3	23976.32	10.2947

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002350	5255807	Isolate	United States	North America

• Gene Location: Start: 134883; End: 135548 Strand: +

Full Sequence      

MKTKIGCLTAILLLSGCAKDPQTASNISGSGTTRGGWLKPPPQAPVNRTGTPVVYNDYIR
QAASNYGVDETLIKAIIQVESGFNPNVVSTSNAVGLMQLKASTAGRDAYRMKGRSGQPSS
RELKDPAVNIDLGTAYINILQSQQLAGINNPQTLRYATIVSYVNGAGAMLRTFSSDKRVA
VNRINQMSPDEFYQHIQKKHPAPQAPRYLWKVTTAYQAMSQ

Enzyme Prediction     

No EC number prediction in MGYG000002350_03919.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	71	219	2.1e-19	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	4.84e-91	57	217	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	2.87e-80	11	219	10	203	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	2.58e-72	55	215	192	352	membrane-bound lytic murein transglycosylase MltC.
COG0741	MltE	1.09e-33	37	215	121	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.91e-30	59	180	1	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWQ47667.1	4.17e-158	1	221	1	221
AWL66842.1	4.17e-158	1	221	1	221
QFH62661.1	4.17e-158	1	221	1	221
QSD89017.1	4.17e-158	1	221	1	221
AVU35175.1	4.17e-158	1	221	1	221

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	4.51e-64	60	219	27	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	6.01e-64	60	219	44	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
4HJY_A	6.61e-64	26	219	14	206	2.4A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJY_B 2.4 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_A 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_B 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12]
6GHY_A	1.28e-63	60	219	27	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	1.28e-63	60	219	27	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7MKC3	4.65e-68	11	219	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=emtA PE=3 SV=2
A8AFS5	3.53e-65	61	219	45	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=emtA PE=3 SV=1
B7LSJ1	3.53e-65	11	219	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=emtA PE=3 SV=1
B5XQ85	1.16e-63	37	219	22	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=emtA PE=3 SV=1
P0C960	3.29e-63	60	219	44	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=emtA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000061	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002350_03919.