CAZyme Information: MGYG000002351_00441

Basic Information

• Species: Klebsiella_A michiganensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A michiganensis
• CAZyme ID: MGYG000002351_00441
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576	MGYG000002351_1|CGC9	65443.39	6.4621

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002351	6684898	Isolate	United States	North America

• Gene Location: Start: 460145; End: 461875 Strand: +

Full Sequence      

MVVEMADEVVSPSQYLIDWMLSKHWNVPEERHVILNCEPFQGFETRSDVVVKTNETPASG
VELVFFGRLETRKGLDIFLRALRKLSDEDKETISGVTFLGKNVTLGKIDSFTYIMNQTKN
LGLAVNIISDYDRTNANEYIKRKNVLVIIPSLVENSPYTVYECLVNNVNFLASNVGGIPE
LIPQEHHAEVLFTPTPVDLYGKIHYRLKNINIKPGLVESQENIQAAWFAAIERKDNSVFK
KIDELNRPLVSVCITHFDRHHLLQQALASIKTQTYQNIEVILVDDGSTKEESHRYLNLIE
NDFNARGWKIIRSSNNYLGAARNLAARHASGEYLMFMDDDNVAKPFEVETFVTAALNSGA
DVLTTPSDLIFGEEFPSPFRKMTHCWLPLGPDLNIASFSNCFGDANALIRKEAFDNIGGF
TEDYGLGHEDWEFFAKVSLQGYKLQLVPEPLFWYRVANSGMLLSGNKSKNNYRSFRPFMD
ENVKYNYAMGLIPAYLEKIHELESEVSRLRSINGGHSVSNELQLLNHKIDGLISQQRDGW
AHDRFNALYEAIHVQGANRGRSLVRRVGRKVKSLLK

Enzyme Prediction     

No EC number prediction in MGYG000002351_00441.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	251	417	4e-26	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	2.59e-25	251	414	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	9.13e-25	252	443	1	153	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04186	GT_2_like_c	1.21e-21	254	456	3	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.88e-19	246	532	1	301	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04196	GT_2_like_d	1.48e-18	262	455	13	203	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIE68257.1	0.0	1	576	165	740
ASK75117.1	0.0	1	576	165	740
APM32752.1	0.0	1	576	165	740
ASZ55686.1	0.0	1	576	165	740
QAS65673.1	0.0	1	576	165	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.21e-12	246	525	3	289	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57022	1.34e-10	245	341	1	95	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1
Q57287	2.13e-10	246	485	3	243	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1
P11290	1.39e-08	250	525	8	285	Uncharacterized glycosyltransferase YibD OS=Escherichia coli (strain K12) OX=83333 GN=yibD PE=3 SV=2
P71054	4.98e-08	248	445	5	200	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
A0A0H2UR96	5.98e-08	249	363	4	116	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002351_00441.