CAZyme Information: MGYG000002351_00806

Basic Information

• Species: Klebsiella_A michiganensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A michiganensis
• CAZyme ID: MGYG000002351_00806
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645	MGYG000002351_1|CGC12	73230	9.0063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002351	6684898	Isolate	United States	North America

• Gene Location: Start: 845147; End: 847084 Strand: +

Full Sequence      

MEKAKTVTWRLLAAGVSLLTLSQLAHADSLDEQRSRYAQIKQAWDSRQMDVVNQLMPTLT
TYPLYPYLQYRQITDDLMNQPALVVTNFIAANPTLPPARSLKSRFVNELARRSDWRGLLA
FSPDKPTGTEAQCNYYYAKWNVGQAQEAWDGAKALWLSGKSQPNACDQLFGAWRASGQQD
PLAYLERIRLAMKAGNTSLVRVLAQQMPADYQTISTAVIALANDPNSVMTFARTTGATDF
TRQMAAVAFASVARQDVENARLMIPSLAQAQQLNEDQIQELRDIVAWRLMGSDVTEEQAI
WRDDAIMRSQSTSLVERRVRMALGLGDRRGLNTWLARLPMEAKEKDEWRYWQADLLLERG
RDDEAKDILRSLMQQRGFYPMVAAQRLGEEYRFRIDKAPANLDPALTSGPEMARVRELMY
WNMDNTARSEWANLVTSKTKDQQAQLARYAFNQNWWDLSVQATIAGKLWDQLEERFPLAY
NDLFTRYISGKDIPQSYAMAIARQESAWNPKAGSPVGARGLMQIMPGTATHTVSMFSIPG
YSGPSQLLDPEMNINIGTSYLQYVYQQFGNNRIFASAAYNAGPGRVRTWRGNSGGRIDAV
AFIESIPFSETRGYVKNVLSYDAYYRYFMGQKETLLSDAEWKLRY

Enzyme Prediction     

No EC number prediction in MGYG000002351_00806.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	498	622	2.3e-31	0.7555555555555555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11619	PRK11619	0.0	1	645	1	644	lytic murein transglycosylase; Provisional
cd13401	Slt70-like	1.14e-66	475	627	1	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	1.76e-49	346	638	1	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16896	LT_Slt70-like	7.74e-43	477	621	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	4.63e-38	493	600	10	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOV10351.1	0.0	1	645	1	645
QET49994.1	0.0	1	645	1	645
QTH50672.1	0.0	1	645	1	645
QTN54629.1	0.0	1	645	1	645
QUG45974.1	0.0	1	645	1	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	0.0	28	645	1	618	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	0.0	28	645	1	618	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
5OHU_A	2.62e-90	18	645	13	638	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	3.04e-87	32	645	1	610	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FBT_A	5.41e-87	33	645	1	609	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	0.0	1	645	1	645	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	0.0	1	645	1	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	0.0	1	645	1	645	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P44888	1.73e-71	272	640	227	587	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P39433	1.01e-16	604	645	1	42	Soluble lytic murein transglycosylase (Fragment) OS=Enterobacter cloacae OX=550 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000376	0.998727	0.000317	0.000202	0.000187	0.000175

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002351_00806.