CAZyme Information: MGYG000002351_02408

Basic Information

• Species: Klebsiella_A michiganensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A michiganensis
• CAZyme ID: MGYG000002351_02408
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
786	MGYG000002351_1|CGC40	86304.17	4.748

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002351	6684898	Isolate	United States	North America

• Gene Location: Start: 2577747; End: 2580107 Strand: +

Full Sequence      

MNNDFNTTLAAMSAEEKVALLTGSGLWRTASLPQHGIEDIIMTDGTYGVRYSSAQIDGRE
KWSMDDFISVITQTADQASAEEPAAKGGSEALFSTSLPATCFPNGSSLACSWDVELVHQM
GEALGRECQQMGVGILLGPGINIRRTPLAGRGYEYYAEDPVVSGDIAAALINGLQQEGVG
ASLKHFAANNSEYRRTEMDSIIEERALREIYLAGFQRAIAKSRPWTVMSSYNRLNGVQTS
QDPFLLTQVLRDEWGYEGLVMSDWYGIKDRPASLMAGNDLAMPETRRDKQTLLAAIEAGE
VPMAVVDRACLRMLELLDKVQRHRRPQTRADFTAHHALAQRLAGESIVLLKNEDNLLPLR
PEKTPRVAVLGKPAQEPVIQGSGCATTVPYLLDRPLDEIFDLAGDDFSVSWAVGAPDDLR
CDEQALAQACRVAQEADVAVIFVSTAVGEDGENGDRQDLHILPVHERLIREVATVQPNIV
VVLANSDAVVMPWLGECKALLETFFAGQGMGRAVAEILFGQRNPCGKLTVTVPNSLEETP
AWLHYPGENLRHHYGEGLFVGYRYYDKRRMTPQFPFGFGLSYTRFAYDNIALSACRAGAG
ETLTVSFDLTNCGEYAGKEIVQLYVSAPKGELIREVQSLKAFSKVALAAGETRRVSLQLP
IGELACYHPGLGDWVVTPGIWQVRVGASSRDLPLIAEIEVDCPQRYVPLRDDNSLQQLIQ
QPEAFARVVKLIADKSQMPAEQVREKLIRLAPDLFCGLLIALTEFLALDIERDELNAVLA
GAHHCQ

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	283	5.9e-63	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.31e-94	100	691	118	756	beta-glucosidase BglX.
COG1472	BglX	3.78e-69	99	392	80	380	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	7.67e-59	347	562	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.97e-44	68	316	48	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	9.81e-43	99	657	111	740	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZG76372.1	0.0	1	786	1	786
AID89796.1	0.0	1	786	1	786
ASK71731.1	0.0	1	786	1	786
AUV92763.1	0.0	1	786	1	786
AFN32098.1	0.0	1	786	1	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.02e-178	4	745	4	717	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.19e-156	12	734	12	697	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.66e-126	6	708	5	721	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.03e-125	6	708	5	721	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	3.98e-94	4	701	5	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	5.57e-178	4	745	4	717	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	1.62e-151	12	733	12	704	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	8.98e-151	12	733	12	704	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
P27034	9.27e-120	9	707	6	815	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
Q2U8Y5	1.14e-112	4	689	5	820	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002351_02408.