CAZyme Information: MGYG000002351_03460

Basic Information

• Species: Klebsiella_A michiganensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A michiganensis
• CAZyme ID: MGYG000002351_03460
• CAZy Family: GH37
• CAZyme Description: Periplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	MGYG000002351_1|CGC50	64721.79	5.4128

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002351	6684898	Isolate	United States	North America

• Gene Location: Start: 3697034; End: 3698782 Strand: +

Full Sequence      

MTSPVSRRPATLPFALRLALGGAFVALATLTAQAEETRPTPQSPDILLGPLFNDVQSAKL
FSDQKTFADAIPNGDPLMILADYRMQKSQTSFDLRHFVELNFTLPRENDQYVPPKGQTLR
QHINGLWPVLTRSTVDVEKWDSLLPLPKPYVVPGGRFREVYYWDSYFTMLGLAESGHWDK
IEDMVTNFAAEIDAWGHIPNGNRTYYLSRSQPPFFPFMVELLATHEGDEALKKWLPQMEK
EYQYWMDGAEALEPGSASKRVVRMADGALLNRYWDDNDTPRPESWLDDVTTAKNNPNRPA
TEIYRDLRSAAASGWDFSSRWMDNPQQLGTIRTTSIVPVDLNSLMFHMEKAIARASKAAG
DSAKSAQYDALANARQKALEKYLWNDKEGWYADYDLKSHKVRNQLTAAALFPLYVNAASS
ERAAKVAAATEARLLKPGGLTTTTVNSGQQWDAPNGWAPLQWVAAEGLQKYGQQTIAMEV
SWRFLSNVQHTYNSEQKLVEKYDVSSTGTGGGGGEYPLQDGFGWTNGVTLKMLDLVCPKE
KPCDSVPTARPAANDDNGKAADVSAQPAAQQPAAVEEKKVAP

Enzyme Prediction     

EC	3.2.1.28

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	60	535	1.1e-188	0.9959266802443992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13270	treF	0.0	51	535	62	545	alpha,alpha-trehalase TreF.
PRK13272	treA	0.0	11	539	6	539	alpha,alpha-trehalase TreA.
COG1626	TreA	0.0	32	542	42	558	Neutral trehalase [Carbohydrate transport and metabolism].
PRK13271	treA	0.0	1	556	1	556	alpha,alpha-trehalase TreA.
pfam01204	Trehalase	0.0	59	535	1	507	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUV91771.1	0.0	1	582	1	582
AID90811.1	0.0	1	582	1	582
QQO66991.1	0.0	1	582	1	582
APM30330.1	0.0	1	582	1	582
AUW01423.1	0.0	1	582	1	582

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JG0_A	0.0	35	567	1	533	Family37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	0.0	43	556	46	559	Structureof periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	2.75e-316	35	567	1	533	Family37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
7E9U_A	1.64e-81	121	534	123	552	ChainA, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	2.42e-80	121	534	123	552	ChainA, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7MK99	0.0	1	551	1	547	Periplasmic trehalase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) OX=585035 GN=treA PE=3 SV=1
C4ZTN8	0.0	1	567	1	563	Periplasmic trehalase OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=treA PE=3 SV=1
B7NUW3	0.0	1	551	1	547	Periplasmic trehalase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) OX=585057 GN=treA PE=3 SV=1
B7N408	0.0	1	551	1	547	Periplasmic trehalase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=treA PE=3 SV=1
P13482	0.0	1	567	1	563	Periplasmic trehalase OS=Escherichia coli (strain K12) OX=83333 GN=treA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000493	0.998693	0.000233	0.000219	0.000177	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002351_03460.