CAZyme Information: MGYG000002351_03648

Basic Information

• Species: Klebsiella_A michiganensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A michiganensis
• CAZyme ID: MGYG000002351_03648
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
155	MGYG000002351_1|CGC55	16910.52	8.7476

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002351	6684898	Isolate	United States	North America

• Gene Location: Start: 3878832; End: 3879299 Strand: -

Full Sequence      

MSRIIDILSFEEGYREKPYLDTLGFPTVAGGIKIGPKNAPLSYYAFTVPKAVGDVWKQVF
VDKTIAEMNGYPAITAALNVCNDARRDVLFSMAYQMGVPGLAGFKNTLALIAASNFESAA
KGMLNSLWAKQTPERAARHSDVMRSGTYDAYMGLI

Enzyme Prediction     

No EC number prediction in MGYG000002351_03648.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00735	T4-like_lys	8.96e-62	4	150	2	146	bacteriophage T4-like lysozymes. Bacteriophage T4-like lysozymes hydrolyze the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1), as well as Dictyostelium.
PHA02596	5	5.12e-27	4	151	175	336	baseplate hub subunit and tail lysozyme; Provisional
cd00737	lyz_endolysin_autolysin	0.006	5	124	2	111	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUV91602.1	2.32e-109	1	155	1	155
AID90995.1	2.32e-109	1	155	1	155
QCA04882.1	1.68e-77	1	155	1	155
QGY58492.1	5.62e-76	1	155	1	155
ADO09145.1	1.87e-74	1	155	1	155

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
159L_A	1.97e-18	4	154	3	164	ChainA, T4 LYSOZYME [Tequatrovirus T4]
137L_A	3.90e-18	4	154	3	164	ChainA, T4 LYSOZYME [Tequatrovirus T4],137L_B Chain B, T4 LYSOZYME [Tequatrovirus T4]
1T8G_A	5.48e-18	4	154	3	164	ChainA, Lysozyme [Tequatrovirus T4]
1L24_A	5.48e-18	4	154	3	164	ChainA, T4 LYSOZYME [Tequatrovirus T4]
2B7X_A	6.25e-18	4	154	3	170	ChainA, Lysozyme [Tequatrovirus T4],2B7X_B Chain B, Lysozyme [Tequatrovirus T4],2B7X_C Chain C, Lysozyme [Tequatrovirus T4],2B7X_D Chain D, Lysozyme [Tequatrovirus T4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P00720	1.78e-15	4	154	3	164	Endolysin OS=Enterobacteria phage T4 OX=10665 GN=E PE=1 SV=2
Q556F2	6.31e-13	1	151	2	169	Probable T4-type lysozyme 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274831 PE=3 SV=1
P16009	2.30e-09	6	151	178	339	Pre-baseplate central spike protein Gp5 OS=Enterobacteria phage T4 OX=10665 GN=5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002351_03648.