CAZyme Information: MGYG000002351_05606

Basic Information

• Species: Klebsiella_A michiganensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A michiganensis
• CAZyme ID: MGYG000002351_05606
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		40869.38	9.6102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002351	6684898	Isolate	United States	North America

• Gene Location: Start: 5934771; End: 5935853 Strand: -

Full Sequence      

MRIVKQFTRKKNAFFREIKFNLINYRYRNKSARQPFNSAKIQHVLLLRLDDKVGDMVVTT
GCAKLLADRGYKVSVLTGPVCKQMLAGADFLEQVYLYQPRMPLNALRAAGFDAVVDFDDV
KTYERFKLLADLRPGCVIGFNKQEYKLYDHSIPFLDSSSHISARYKAVARLFGIEHPHYH
YHLPGDAFERERVKTLLAQHKGSQLCIAINPFTASTDKDFCRHQVSALIERLYTLPYKIS
VVMVGHSEKIRQLNLETALHLPDSNINSAVEIVRHCDLVITADTAIVHIARAFDKPMVAV
YNKRKLKDTGLPGYTIWAPGYDKARQIVCEETNVADMTIDAVWPAIKAQADALIAARQQA

Enzyme Prediction     

No EC number prediction in MGYG000002351_05606.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	104	310	4.9e-23	0.8266666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	3.58e-22	41	356	1	332	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	6.19e-14	43	327	1	240	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	8.25e-07	105	301	7	209	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10916	PRK10916	3.42e-05	177	301	198	287	ADP-heptose--LPS heptosyltransferase RfaF.
TIGR02195	heptsyl_trn_II	4.78e-04	248	301	223	277	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSW14699.1	2.43e-263	1	360	1	360
AOV14685.1	2.43e-263	1	360	1	360
AEX02910.1	2.43e-263	1	360	1	360
AIE67722.1	2.43e-263	1	360	1	360
AHW86332.1	2.43e-263	1	360	1	360

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27242	3.55e-26	7	347	6	349	Lipopolysaccharide 1,2-N-acetylglucosaminetransferase OS=Escherichia coli (strain K12) OX=83333 GN=waaU PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002351_05606.