CAZyme Information: MGYG000002351_06293

Basic Information

• Species: Klebsiella_A michiganensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A michiganensis
• CAZyme ID: MGYG000002351_06293
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
161		18184.87	9.8849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002351	6684898	Isolate	United States	North America

• Gene Location: Start: 111382; End: 111867 Strand: +

Full Sequence      

MKGVAFGIILSLIPLSSMAADCFDMAGRDYKIDPDLLRAISWQESRFKIDAIGRNPVTGY
GSGLMQIDSQHFNELSRYGIKPDHLLSDACLNIYTGAYYLAQAFKKWGVSWDTVGAYNAG
FKKTPRQAARRYEYAKKIHYYYTAIKASKRTSSKDQKIAMN

Enzyme Prediction     

No EC number prediction in MGYG000002351_06293.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	33	150	4.6e-19	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13722	PRK13722	2.14e-74	1	149	1	149	lytic transglycosylase; Provisional
cd13400	LT_IagB-like	1.79e-45	30	143	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	7.57e-36	5	161	4	159	type III secretion system invasion protein IagB.
pfam01464	SLT	9.74e-21	23	139	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	5.13e-15	26	149	146	275	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHW72099.1	7.11e-116	1	161	1	161
AKA86904.1	7.11e-116	1	161	1	161
AID93547.1	7.11e-116	1	161	1	161
QJO75495.1	7.11e-116	1	161	1	161
ASU05195.1	7.11e-116	1	161	1	161

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	3.92e-18	21	105	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14499	1.77e-73	1	149	1	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P47737	3.57e-73	1	149	1	149	X polypeptide OS=Escherichia coli (strain K12) OX=83333 GN=yubQ PE=3 SV=1
P17738	1.02e-72	1	149	1	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
Q00739	8.36e-72	1	149	1	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P43018	1.83e-26	6	161	5	159	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002406	0.988468	0.007988	0.000406	0.000334	0.000340

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002351_06293.