CAZyme Information: MGYG000002353_01100

Basic Information

• Species: Enterococcus_B faecium
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B faecium
• CAZyme ID: MGYG000002353_01100
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
211	MGYG000002353_1|CGC21	22458.12	4.031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002353	3157885	Isolate	Netherlands	Europe

• Gene Location: Start: 1113190; End: 1113825 Strand: +

Full Sequence      

MSRKDRHQSTENNETQEPWEQPIYDTDDEVSSRSSQRQQKKGNTLFLSLFLILLVLCIAI
PAGAYFWIRNGSSNNATAATSSETSTSVVESSTSTTKEESTETSTVESSTIAEESTVSQD
TGVTSESSIAAETTPTSSSEATYQAGDSSSNAAETTPSSSAAAGSTTTVQAGEGPKQVAE
RAGITTDQLFELNGLDPNNFMLYPGQELRIK

Enzyme Prediction     

No EC number prediction in MGYG000002353_01100.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	3.45e-07	168	210	4	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	2.02e-06	168	211	2	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	5.42e-05	168	210	3	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTQ80656.1	2.97e-105	1	211	1	211
QTO61688.1	2.97e-105	1	211	1	211
QHU87211.1	2.97e-105	1	211	1	211
QHQ47906.1	2.97e-105	1	211	1	211
BBU65505.1	2.97e-105	1	211	1	211

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999920	0.000099	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
46	68