CAZyme Information: MGYG000002353_01304

Basic Information

• Species: Enterococcus_B faecium
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B faecium
• CAZyme ID: MGYG000002353_01304
• CAZy Family: GH73
• CAZyme Description: Autolysin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295		32120.65	6.7607

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002353	3157885	Isolate	Netherlands	Europe

• Gene Location: Start: 1324361; End: 1325248 Strand: +

Full Sequence      

MQELKTRSARHHRPKRKMVINKKAIAPLIGTSLLVGPMMVTAVPQHVHADEQGSQTVADP
QAFIDQIGWSASEVAASNDLYASVMIAQALLESAYGTSGLASAPNYNLFGVKGSYNGQVV
YMATKEYVNGQWVTMNEPFRKYSSYWESFQDHANVLRSTSFSTGDYHYAGVWKSNTTSFY
DATAYLTGRYATDPNYGAKLNSLINTYNLTRFDTPSTGSATTTTSTTTTTTTTTSTSSSS
TTDVNTNNGQTYTVVSGDTLWDIAQKFGMSVDDLMAKNGMSMSSYSLLVGQELNV

Enzyme Prediction     

EC	3.2.1.-	3.2.1.17	3.2.1.96

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	71	209	3.2e-27	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	3.00e-65	58	295	148	374	1,4-beta-N-acetylmuramoylhydrolase.
COG1705	FlgJ	1.37e-63	21	213	1	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	1.77e-50	39	213	296	472	amidase domain-containing protein.
smart00047	LYZ2	2.38e-37	59	213	7	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	3.52e-22	71	209	4	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDZ47464.1	1.95e-193	1	295	1	295
QMX61798.1	1.95e-193	1	295	1	295
QSQ01213.1	1.95e-193	1	295	1	295
AGS75292.1	1.95e-193	1	295	1	295
QDZ50593.1	1.95e-193	1	295	1	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	2.37e-41	61	213	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	3.48e-33	44	213	41	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	3.81e-17	61	205	2	144	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	4.67e-17	61	205	3	145	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	3.29e-16	61	205	3	145	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	4.50e-71	60	295	180	404	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	1.67e-66	23	295	22	298	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q9CIT4	3.87e-60	20	293	13	282	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	5.19e-60	22	293	18	284	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	1.03e-59	23	293	25	284	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002288	0.996588	0.000270	0.000425	0.000218	0.000192

TMHMM  Annotations     

start	end
24	43