CAZyme Information: MGYG000002353_02484

Basic Information

• Species: Enterococcus_B faecium
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B faecium
• CAZyme ID: MGYG000002353_02484
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307	MGYG000002353_1|CGC35	34388.58	6.491

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002353	3157885	Isolate	Netherlands	Europe

• Gene Location: Start: 2532441; End: 2533364 Strand: -

Full Sequence      

MRMKDKLIIGKNAIDTPTDFETIQEGIDYLAGLPDSHPKVLIVKEGRYDEYIESRLSNFK
LVGAGTVVISGNRFAKQEYLDGSQLGTFRSATFFLEGSNVVLENLHIENTAGPGEKVGQA
VALFNSGDRVSLKNCRLSGYQDTLCTGPLPDLQKDGTPFCTPASANPEYCRQTYEYCWIE
GTVDFIFGGADAVFHQCHIHSLASKNPGYITAASTPKNQKTGYRFESCTLTAEPDTRNVY
LGRPWRPYANVLFEACKIGGHVHPTGWDNWDDKKNEQTVKFSERNNNYETSIKRPEWIHL
EKQGVQK

Enzyme Prediction     

No EC number prediction in MGYG000002353_02484.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	15	300	1e-77	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	3.79e-56	19	297	93	384	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	4.65e-55	13	287	5	262	Pectinesterase.
PLN02773	PLN02773	8.47e-51	13	283	10	262	pectinesterase
PLN02432	PLN02432	1.28e-42	19	299	22	270	putative pectinesterase
PLN03043	PLN03043	1.90e-42	3	297	221	500	Probable pectinesterase/pectinesterase inhibitor; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALZ53106.1	8.76e-237	1	307	1	307
AON59971.1	8.76e-237	1	307	1	307
AUI34459.1	8.76e-237	1	307	1	307
ANB94759.1	8.76e-237	1	307	1	307
QDZ51705.1	8.76e-237	1	307	1	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	5.28e-35	13	287	8	265	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	2.27e-25	20	292	19	277	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	8.46e-25	9	286	5	268	Pectinmethylesterase from Carrot [Daucus carota]
5C1C_A	1.17e-24	20	292	19	277	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	3.60e-21	8	282	7	295	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.69e-36	15	283	12	262	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FF77	2.27e-34	3	286	304	570	Probable pectinesterase/pectinesterase inhibitor 47 OS=Arabidopsis thaliana OX=3702 GN=PME47 PE=2 SV=1
O48711	3.35e-34	13	297	241	510	Probable pectinesterase/pectinesterase inhibitor 12 OS=Arabidopsis thaliana OX=3702 GN=PME12 PE=2 SV=1
P09607	2.34e-33	9	287	234	498	Pectinesterase 2.1 OS=Solanum lycopersicum OX=4081 GN=PME2.1 PE=2 SV=2
P14280	4.27e-33	4	287	228	494	Pectinesterase 1 OS=Solanum lycopersicum OX=4081 GN=PME1.9 PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002353_02484.